5LEF,5LEF


Conserved Protein Domain Family
RBD_KIF20A-like

?
cd21744: RBD_KIF20A-like 
RAB6 binding domain (RBD) found in kinesin-like proteins KIF20A, KIF20B, and similar proteins
This family includes kinesin-like proteins KIF20A and KIF20B. KIF20A (also called GG10_2, mitotic kinesin-like protein 2 (MKlp2), Rab6-interacting kinesin-like protein, or rabkinesin-6) is a mitotic kinesin required for chromosome passenger complex (CPC)-mediated cytokinesis. Following phosphorylation by PLK1 (polo-like kinase 1), it is involved in recruitment of PLK1 to the central spindle. KIF20A interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B. It may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus-end-directed motility. KIF20B (also called cancer/testis antigen 90 (CT90), kinesin family member 20B, kinesin-related motor interacting with PIN1, or M-phase phosphoprotein 1 (MPP1)) is a plus-end-directed motor enzyme that is required for completion of cytokinesis. It is required for proper midbody organization and abscission in polarized cortical stem cells. KIF20B plays a role in the regulation of neuronal polarization by mediating the transport of specific cargoes. It participates in the mobilization of SHTN1 and in the accumulation of PIP3 in the growth cone of primary hippocampal neurons in a tubulin and actin-dependent manner. In the developing telencephalon, KIF20B cooperates with SHTN1 to promote both the transition from the multipolar to the bipolar stage and the radial migration of cortical neurons from the ventricular zone toward the superficial layer of the neocortex. This model corresponds to a conserved domain in the KIF20A subfamily, that shows RAB6 binding ability and has been called the RAB6 binding domain (RBD). KIF20A-RBD is a dimer composed of two parallel alpha helices that form a right-handed coiled-coil additionally stabilized by an inter-helical cysteine bridge.
Links
?
Statistics
?
PSSM-Id: 409643
Aligned: 92 rows
Threshold Bit Score: 43.597
Created: 17-Aug-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
RAB6 bindinghomodimer
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:RAB6 binding site [polypeptide binding site]
Evidence:
  • Comment:two RAB6 molecules bind on opposite sides of the KIF20A-RAB6-binding domain (KIF20A-RBD) dimer
  • Structure:5LEF: Mus musculus kinesin-like KIF20A RAB6 binding domain (RBD) dimer binds two RAB6 molecules; contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                             # ##  ##  #  ##                    
5LEF_C         2 AMEQWCSERLDNQKELMEELYEEKLKILKESLTTFYQEQIQERDEKIEELETLLQE 57   house mouse
NP_001154942 603 RMQDDFSETLESERDLMEKRCENKINNLKSSLKKYYSQELEERDDEIRELTAALKE 658  zebrafish
XP_007889550 611 SMEKHWREQLVEQKEQLEDFYEAKMKNFQEYVKLYYQSSAADEDENYSDSDHDSDG 666  elephant shark
KPP58879     591 RMENDFSETLETERALMEERYEEKISNLQKNLKRYYTEEIEERDEQIEFLTAALQK 646  Asian bonytongue
XP_028842618 590 RMQNDFSETLETERALIEERYESKISNLETSLKKYYSQEIKEQNEQIQELTTALEK 645  denticle herring
KPP72716     652 RMEKDFSETLETERELMQERYEDKIQNLQKSLRRYYIQEIEERDERIKKLTEELGH 707  Asian bonytongue
CDQ87198     118 GMEKDFSQTLETERALLEERFEDKINNLQKSLRRYYNQEIEERDEQIVALTAALEK 173  rainbow trout
XP_023695190 221 RMQDDFGETLETERTLLEEKHEEKVSNLQTSLRKFYVQEMEERDEQIRELTAELQG 276  Paramormyrops kingsleyae
XP_017273401 600 RMQEDFNETLETQMALIEERYETKLTILETHLKKFYSQELKERDEVIEALSASLEK 655  mangrove rivulus
XP_015248927 600 KMKEDFAETLEVEKGLIEQNYENKLSILEKHLKKYYNQQLKERDQEIEELSAALEE 655  sheepshead minnow

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap