5WAI


Conserved Protein Domain Family
ZnB-Zn_SUZ12-like

?
cd21735: ZnB-Zn_SUZ12-like 
Click on image for an interactive view with Cn3D
zinc finger-binding (ZnB) and C2H2-type zinc finger (Zn) domain found in suppressor of zeste 12 protein (SUZ12), and similar proteins
This family includes a group of Polycomb group (PcG) proteins from metazoa and plants, such as suppressor of zeste 12 protein (SUZ12), and Polycomb group proteins EMBRYONIC FLOWER 2 (EMF2) and FERTILIZATION-INDEPENDENT SEED 2 (FIS2). SUZ12 (also called chromatin precipitated E2F target 9 protein (ChET 9 protein), or joined to JAZF1 protein) is a component of the Polycomb Repressive Complex 2 (PRC2)/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. EMF2 is involved in flowering processes by repressing unknown target genes and preventing reproductive development. It participates in polycomb group (PcG) protein complex-mediated (probably in complex with EMF1) silencing of the flower homeotic genes AGAMOUS (AG), PISTILLATA (PI), and APETALA3 (AP3), as well as of some regulatory genes such as ABSCISIC ACID INSENSITIVE3 (ABI3), LONG VEGETATIVE PHASE1 (LOV1), and FLOWERING LOCUS C (FLC) during vegetative development, by mediating trimethylation of histone 3 lysine 27 on the AG chromatin (H3K27me3). FIS2 is required to prevent the proliferation of the central cell by repressing unknown target genes before fertilization. It regulates the anteroposterior organization of the endosperm. Members in this family contain a unique structural ZnB-Zn platform consisting of zinc finger-binding (ZnB) and C2H2-type zinc finger (Zn).
Statistics
?
PSSM-Id: 439244
Aligned: 4 rows
Threshold Bit Score: 126.099
Created: 13-Oct-2021
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
 
Zn binding site
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1: Zn binding site [ion binding site], 4 residue positions
Conserved feature residue pattern:C C H HClick to see conserved feature residue pattern help
Evidence:
  • Structure:5WAI; Homo sapiens SUZ12 binds Zn2+ ion

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
5WAI_B      7 DHELFLQAFEKPTQIYRFLRTRNLIapiflhrtltymshrnsrtnikrktfkvddmlskvekmkgeqeshslsahlqltf 86  human
Q8L6Y4     37 AAEESLAAYCKPVELYNIIQRRAIRnplflqrclhykieakhkrriqmtvflsgaidagvqtqklfplyillarlvspkp 116 thale cress
CCA22441   37 VENEFIAAYHGVTALYKWLEVKHIQsplflprtlqyrqrqaeklksaeiiyicddsplypgatlrswklelstytlhllr 116 Albugo laibachii Nc14
KUF98423    1 MEEEFAETYHGLTALYKVLEVKHLQsplflprtlsyrldpawqqkevkekkgqkqvknakagatmkdfkigmtsdtmeaf 80  Phytophthora nicot...
Feature 1                                                                                     
5WAI_B     87 tgffhkndkpspnseneqnsvtlevllvkvchkkrkdvscpirqvptgkkqvplnpdlnqtkpgnfpslavssnefepsn 166 human
Q8L6Y4    117 vaeysavyrfsraciltgglgvdgvsqaqanfllpdmnrlaleaksgslailfisfagaqnsqfg--------------- 181 thale cress
CCA22441  117 kefkkvglrlvmysknvkdeaignfemlatctfpvplncgislpskfvqkasrngvivlviqlieldta----------- 185 Albugo laibachii Nc14
KUF98423   81 ksqkqrpgvlislyrangkkfndnqftllatclipvpcskdltlpkefvdlnadicvgvfqvveisdvge---------- 150 Phytophthora nicot...
Feature 1                                                                                     
5WAI_B    167 shmvksysllfrvtrpgrrefngmingetnenidvneelparrkrnredgektfvaqmtvfdknrrlqlldgeyevamqe 246 human
Q8L6Y4    182 ----------------------------------------------------------------idsgkihsgnigghcl 197 thale cress
CCA22441  186 -------------------------------------------------------------tdkkpnamvfqrpstttfv 204 Albugo laibachii Nc14
KUF98423  151 -----------------------------------------------------------tiaaqsafkfaapsvasivsg 171 Phytophthora nicot...
Feature 1                                                                                     
5WAI_B    247 meecpiskkratwetildgkrlppfetfsqgptlqftlrwtgetndkstapiakplatrnseslhqenkpgsvkptqtia 326 human
Q8L6Y4    198 wskiplqslyaswqkspnmdlgqrvdtvslvemqpcfiklksmseekcvsiqvpsnpltssspqqvqvtisaeevgstek 277 thale cress
CCA22441  205 qedeinsfhtdrnrvlcagpvaldprhprrsniavelksvtlstdktdsllvkckflilweaidkasktkklsnllhkke 284 Albugo laibachii Nc14
KUF98423  172 kdllstcangrkplfgnllrlnvsrrrvgyvtvelpaiassvsggvkcefriswdplpktkkmqrlasicdtklksedes 251 Phytophthora nicot...
Feature 1                                                     #  #            #    #          
5WAI_B    327 vkeslttdlqtrkekdtpnenrqkLRIFYQFLYnnNTRQQTEARdDLHCPWCTLNCRkLYSLLKHLKLCHSRFIFNYVYH 406 human
Q8L6Y4    278 spyssfsyndissssllqiirlrtGNVVFNYRYynNKLQKTEVTeDFSCPFCLVKCAsFKGLRYHLPSTHDLLNFEFWVT 357 thale cress
CCA22441  285 nlwnandtftaiqsrkkaveqtvnEPVWFHYLFdkNLRRRNEFRnDLVCPWCNMLTAsLRGLLTHLTCSHDRLHFSFEIG 364 Albugo laibachii Nc14
KUF98423  252 kqsdenfalavpkrdvtsaerkpcSGVWFHFLYhsMLRRMSEKRmEYSCAWCNMFAGsLRGLVAHLVSSHDRFRFQATVG 331 Phytophthora nicot...
Feature 1                     
5WAI_B    407 P-KGARIDVSINECYD 421 human
Q8L6Y4    358 E-EFQAVNVSLKTETM 372 thale cress
CCA22441  365 HdLTPHIHVKRQEYQF 380 Albugo laibachii Nc14
KUF98423  332 HdNIPHIYVMVMQEPQ 347 Phytophthora nicotianae

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap