6JYT,5WWP


Conserved Protein Domain Family
betaCoV_Nsp13-helicase

?
cd21722: betaCoV_Nsp13-helicase 
helicase domain of betacoronavirus non-structural protein 13
This model represents the helicase domain of non-structural protein 13 (Nsp13) from betacoronavirus, including pathogenic human viruses such as Severe acute respiratory syndrome coronavirus (SARS-CoV), SARS-CoV2 (also called 2019 novel CoV or 2019-nCoV), and Middle East respiratory syndrome-related (MERS) CoV. Helicases catalyze NTP-dependent unwinding of nucleic acid duplexes into single strands and are classified based on the arrangement of conserved motifs into six superfamilies. CoV Nsp13 is a member of the helicase superfamily 1 (SF1); SF1 and SF2 helicases do not form toroidal structures, while SF3-6 helicases do. Nsp13 is a component of the viral RNA synthesis replication and transcription complex (RTC). It is a multidomain protein containing a Cys/His rich zinc-binding domain (CH/ZBD), a stalk domain, a 1B domain involved in nucleic acid substrate binding, and a SF1 helicase core.
Statistics
?
PSSM-Id: 409655
Aligned: 26 rows
Threshold Bit Score: 672.282
Created: 6-May-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 11 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to other helicases of the SF1 family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                        ######                                        
6JYT_A     253 GLYPTLNISDeFSSNVANYQKvgxQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKC 332  Severe acute res...
5WWP_B     253 GLYPTITVPEeFASHVANFQKsgySKYVTVQGPPGTGKSHFAIGLAIYYPTARVVYTACSHAAVDALCEKAFKYLNIAKC 332  Human betacorona...
QDF43839  5419 GLYPALNVPEsFVSNVVHYQRigmARYTTVQGPPGTGKSHLSIGLALYYPSAKIVYTACSHAAVDALCEKAHKNLPINRC 5498 Coronavirus BtRt...
AOG30811  5458 GLYPALNVPEaFVTNVVHYQRvgmARYTTVQGPPGTGKSHLSIGLALYYPSAKIVYTACSHAAVDALCEKALKHLPINRC 5537 Rousettus bat co...
BBJ36006  5663 GLYPTITVPEeFANHVANFQKagySKYVTVQGPPGTGKSHFAIGLAIYYPTARIVYTACSHAAVDALCEKAFKYLNIGKC 5742 Bat coronavirus
ABN10892  5651 GLYPTLTVPEeFANHVANFQKvgfSKFVTVQGPPGTGKSHFAIGLAIYYPTARVVYTACSHAAVDALCEKAFKYLNIAKC 5730 Bat coronavirus ...
AUM60023  5560 GLYPTITVPEeFANHVANFQKvgfVKFSTVQGPPGTGKSHFAIGLAIYYPTARIVYTACSHAAVDALCEKAFKYLNIAKC 5639 Middle East resp...
ADX59473  1183 GLYPALNISAdYTGNIVHYQRigmSRYTTVQGPPGTGKSHLAIGLALYYPSAKVVYTACSHAAVDALCEKAFKSLPINRC 1262 Eidolon bat coro...
QGA70691  5568 GLYPTITVPEeFSNHVVNFQKvgySKFVTVQGPPGTGKSHFAIGLAIYYPTARIIYTACSHAAVDALCEKAFKYLNIAKC 5647 Erinaceus hedgeh...
P0C6W1    5612 GIYPTITVPEeFANHVVNFQKagfSKYVTVQGPPGTGKSHFAIGLAIYYPTARIVYTACSHAAVDALCAKAFKYLNIAKC 5691 Bat coronavirus ...
Feature 1                                                                               #      
6JYT_A     333 SRIIPARARVECFDKFKVNStleQYVFCTVNALPETTADIVVFDEISXATNYDLSVVNARLRAKHYVYIGDPAQLPAPRT 412  Severe acute res...
5WWP_B     333 SRIIPAKARVECYDRFKVNEtnsQYLFSTINALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRT 412  Human betacorona...
QDF43839  5499 SRIVPAKARVECFNKFKVNDvsaQYVFSTINALPETTTDILVVDEVSMCTNYDLSMINARVRAKHIVYVGDPAQLPAPRT 5578 Coronavirus BtRt...
AOG30811  5538 SRIVPAKARVECFNRFKVNDvgsQYVFSTINALPETTADILVVDEVSMCTNYDLSMINARVRAKHIVYVGDPAQLPAPRT 5617 Rousettus bat co...
BBJ36006  5743 SRIIPAKARVECYDRFKVNEtnsQYLFSTINALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRT 5822 Bat coronavirus
ABN10892  5731 SRIIPAKARVECYDQFKVNEtnsQYLFSTINALPETSADILVVDEVSMCTNYDLSVINARIKAKHIVYVGDPAQLPAPRT 5810 Bat coronavirus ...
AUM60023  5640 SRIIPAKARVECYDRFKVNEtnsQYLFSTVNALPETSADILVVDEVSMCTNYDLSIINARVKAKHIVYVGDPAQLPAPRT 5719 Middle East resp...
ADX59473  1263 SRVVPAKARVECFSKFKVNEvsaQYVFSTINALPETTTDILVVDEVSMCTNYDLSIINARIRAKHIVYIGDPAQLPAPRT 1342 Eidolon bat coro...
QGA70691  5648 SRIIPAKARVECYDRFKVNEtnlQYVFSTINALPETTADILVVDEVSMCTNYDLSIINSRIKAKHIVYVGDPAQLPAPRT 5727 Erinaceus hedgeh...
P0C6W1    5692 SRIIPAKARVECYDRFKVNDtnaQYLFSTVNALPEISVDILVVDEVSMCTNYDLSIINSRVKAKHIVYVGDPAQLPAPRT 5771 Bat coronavirus ...
Feature 1                                      #                                               
6JYT_A     413 LLtKGTLEPeyFNSVCRLXKTIGPDXFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKxFYKGVITHDVSSAINR 492  Severe acute res...
5WWP_B     413 LLtRGTLEPenFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKiLYKGNVTHDASSAINR 492  Human betacorona...
QDF43839  5579 LLtKGTLAPehFNSVCRLMVAVGPDIFLATCYRCPKEIVDTVSALVYDNKLKANKPATEECYKcYYKGSVTHDSSSAINR 5658 Coronavirus BtRt...
AOG30811  5618 LLtKGTLAPehFNSVCRIMVAVGPDIFLATCYRCPKEIVDTVSALVYDNKLKANKGSTGECFKcYYRGSVTHDASSAINR 5697 Rousettus bat co...
BBJ36006  5823 LLtRGTLEPenFNSVTRLMCNLGPDIFLSMCYRCPREIVNTVSALVYNNKLLAKKEPSGQCFKiLYKGSVTHDASSAINR 5902 Bat coronavirus
ABN10892  5811 LLtRGTLEPenFNSVTRLMCNLGPDIFLSVCYRCPEEIVNTVSALVYNNKLVAKKPASGQCFKiLYKGSVTHDASSAINR 5890 Bat coronavirus ...
AUM60023  5720 LLtRGTLEPenFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLSKKDASAQCFKiLYKGSVTHDASSAINR 5799 Middle East resp...
ADX59473  1343 LLtKGTLGPehFNSVCRIMVAVGPDIFLATCYRCPKEIVSTVSALVYDNKLKANKESTKECFKcFYKGSVTHDSSSAINK 1422 Eidolon bat coro...
QGA70691  5728 LLtRGTLEPenFNSVTRYMCNLGPDIFLGTCYRCPKEIVTTVSALVYNNKLLSKKEQSGQCFKvLYKGSVTHDASSAINR 5807 Erinaceus hedgeh...
P0C6W1    5772 LLtRGTLEPenFNSVTRLMCNLGPDIFLSVCYRCPKEIVNTVSALVYNNKLSAKKDASGQCFKiLFKGSVTHDASSAINR 5851 Bat coronavirus ...
Feature 1                                                     # #                          #   
6JYT_A     493 PQIGVVREFLTRNPaWRKAVFISPYNSQNAVAskILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKI 572  Severe acute res...
5WWP_B     493 PQLTFVKNFITANPaWSKAVFISPYNSQNAVSrsMLGLTTQTVDSSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQK 572  Human betacorona...
QDF43839  5659 PQLGLVKEFLVKNPkWQNAVFISPYNSQNAVArrVLGLQTQTVDSSQGSEFDYVIYCQTSDTAHALNVNRFNVAITRAKR 5738 Coronavirus BtRt...
AOG30811  5698 PQLNLVKEFLTQNPkWQDAVFISPYNSQNAVArrMLGLQTQTVDSSQGSEFDYVIYCQTSDTAHALNANRFNVAITRAKK 5777 Rousettus bat co...
BBJ36006  5903 PQLTFVKSFIAANPaWSKAVFISPYNSQNAVArsMLGLSTQTVDSSQGSEYPYVIFCQTADTAHANNLNRFNVAVTRAQK 5982 Bat coronavirus
ABN10892  5891 PQLNFVKSFIAANPnWSKAVFISPYNSQNAVArsVLGLTTQTVDSSQGSEYPYVIFCQTADTAHANNINRFNVAVTRAQK 5970 Bat coronavirus ...
AUM60023  5800 PQLTFVKSFITANPaWSKAVFISPYNSQNAVArsMLGLTTQTVDSSQGSEYPYVIFCQTADTAHANNINRFNVAVTRAQK 5879 Middle East resp...
ADX59473  1423 PQLSLVREFLLQNPkWQTAVFISPYNSQNSVArrMLGLQTQTVDSSQGSEFDYVIYCQTSDTSHAVNVNRFNVAITRAKK 1502 Eidolon bat coro...
QGA70691  5808 PQLLFVKNFIAANPaWSKAVFISPYNSQNAVArsMLGLNTQTVDSSQGSEYPYVIFCQTADTAHANNINRFNVAVTRAQK 5887 Erinaceus hedgeh...
P0C6W1    5852 PQLNFVKTFIAANPnWSKAVFISPYNSQNAVArsMLGLTTQTVDSSQGSEYPYVIFCQTADTAHANNLNRFNVAVTRAQK 5931 Bat coronavirus ...
Feature 1                          
6JYT_A     573 GILCIXsdrdLYDKLQFTSL 592  Severe acute respiratory syndrome-related coronavirus
5WWP_B     573 GILCVMtsqaLFESLEFTEL 592  Human betacoronavirus 2c EMC/2012
QDF43839  5739 GILCVMsdsnLYESLKFTPL 5758 Coronavirus BtRt-BetaCoV/GX2018
AOG30811  5778 GILCVMsdstLYDALDFVPM 5797 Rousettus bat coronavirus
BBJ36006  5983 GILCVMtsqsLFESLQFAEL 6002 Bat coronavirus
ABN10892  5971 GILCVMtsqaLFDSLEFAEV 5990 Bat coronavirus HKU5-3
AUM60023  5880 GILCVMtsqaLFDSLQFAEL 5899 Middle East respiratory syndrome-related coronavirus
ADX59473  1503 GILCVMsdqnLFDSLLFETL 1522 Eidolon bat coronavirus/Kenya/KY24/2006
QGA70691  5888 GILCVMtsqsLFDSLQFAEL 5907 Erinaceus hedgehog coronavirus HKU31
P0C6W1    5932 GILCVMtsqvLFDSLEFAEL 5951 Bat coronavirus (BtCoV/133/2005)

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap