Conserved Protein Domain Family
TM_Y_MHV-like_Nsp3_C

?
cd21714: TM_Y_MHV-like_Nsp3_C 
C-terminus of non-structural protein 3, including transmembrane and Y domains, from murine hepatitis virus and betacoronavirus in the A lineage
This model represents the C-terminus of non-structural protein 3 (Nsp3) from betacoronavirus in the embecovirus subgenus (A lineage), including murine hepatitis virus (MHV) and Human coronavirus HKU1. This conserved C-terminus includes two transmembrane (TM) regions TM1 and TM2, an ectodomain (3Ecto) between the TM1 and TM2 that is glycosylated and located on the lumenal side of the ER, an amphiphatic region (AH1) that is not membrane-spanning, and a large Y domain of approximately 370 residues. Nsp3 is a large multi-functional multi-domain protein that is an essential component of the replication/transcription complex (RTC), which carries out RNA synthesis, RNA processing, and interference with the host cell innate immune system. In MHV and the related Severe acute respiratory syndrome-related coronavirus (SARS-CoV), the TM1, 3Ecto and TM2 domains are important for the papain-like protease (PL2pro) domain to process Nsp3-Nsp4 cleavage. It has also been shown that the interaction of 3Ecto with the lumenal loop of Nsp4 is essential for ER rearrangements in cells infected with SARS-CoV or MHV. The Y domain, located at the cytosolic side of the ER, consists of the Y1 and CoV-Y subdomains, which are conserved in nidovirus and coronavirus, respectively. Functional information about the Y domain is limited; it has been shown that Nsp3 binding to Nsp4 is less efficient without the Y domain.
Statistics
?
PSSM-Id: 409662
Aligned: 39 rows
Threshold Bit Score: 1041.26
Created: 30-Apr-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
TM1 [structuralTM2 [structural
Feature 1:TM1 [structural motif]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ######################                                                          
P0C6V0    2282 VSRGFFLVATVFLLWFNFLYANVILSDFYLPNIGPLPTFVGQIVAWFKTTFGVSTICDFYQVTDlgyRSSFCNgSMVCEL 2361 Murine hepatitis...
ANJ04970  2195 VARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIAQWIKNTFSLVTICDLYSIQDvgfKNQYCNgSIACQL 2274 Bovine coronavirus
QEY10622  2195 VARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIAQWIKNTFSLVTICDLYSIYDvgfKNQYCNgSIACQF 2274 Dromedary camel ...
ANJ04725  2195 VARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGNIAQWIKNTFSLVTICDLYSIHDvgfKNQYCNgSIACQF 2274 Betacoronavirus 1
AQT26494  2195 VARGACIIATIFLLWFNFLYANVIFSDFYLPKIGFLPTFVGKIVQWIKNTFSLVTICDLYFIQDvgfKNHYCNgSIACQF 2274 Canine respirato...
BAS18843  2233 VARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPAFVGKIVQWIKNTFSFVTICDLYSIQDvgfKNQYCNgSIACQF 2312 Equine coronavirus
QEY10662  2193 VARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIAQWIKNTFSLVTICDLYSIYDvgfKNQYCNgSIACQF 2272 Dromedary camel ...
P0C6X6    2195 VARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIAQWIKNTFSLVTICDLYSIQDvgfKNQYCNgSIACQF 2274 Human coronaviru...
AIV41996  2195 VARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKIAQWIKNTFSLVTICDLYSIQDvgfKNQYCNgSIACQF 2274 Human coronaviru...
AZU96324  2195 VARGACIIATIFLLWFNFIYANVIFSDFYLPKIGFLPTFVGKITQWIKSTFSLVTICDLYSIQDvgfKNQYCNgSIACQF 2274 Yak coronavirus
Feature 1                                                                                      
P0C6V0    2362 CFSGFDMLDNYDAINVVQHVVDRRLSFDYislfKLVVELVIGYSLYTVCFYPLFVLIGMQLLTTWLPEFFMLETMHWSAR 2441 Murine hepatitis...
ANJ04970  2275 CLSGFDMLDNYKAIDVVQYEADRRAFVDYtgvlKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVR 2354 Bovine coronavirus
QEY10622  2275 CLAGFDMLDNYKAIDVVQYEADRRAFVDYtgvlKIVIELIVSYALYTAWFYPLFALISIQILTTWLPEFFMLSTLHWSVR 2354 Dromedary camel ...
ANJ04725  2275 CLAGFDMLDNYKAIDVVQYEADRRVFFDYtgvlKIVIELIVSYALYTSWFYPLFALISIQILTTWLPELFMLSTLHWSVR 2354 Betacoronavirus 1
AQT26494  2275 CLAGFDMLDNYKAIDVVQYEADRRAFVDYtgvlKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVR 2354 Canine respirato...
BAS18843  2313 CLAGFDMLDNYKAIDVVQYEADRRAFVDYtgvlKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVR 2392 Equine coronavirus
QEY10662  2273 CLAGFDMLDNYKAIDVVQYEADRRSFVDYtgvlKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVR 2352 Dromedary camel ...
P0C6X6    2275 CLAGFDMLDNYKAIDVVQYEADRRAFVDYtgvlKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSFR 2354 Human coronaviru...
AIV41996  2275 CLAGFDMLDNYKAIDVVQYEADRRAFVDYtgvlKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSFR 2354 Human coronaviru...
AZU96324  2275 CLAGFDMLDNYKAIDVVQYEADTRAFVDYtgvlKIVIELIVSYALYTAWFYPLFALISIQILTTWLPELFMLSTLHWSVR 2354 Yak coronavirus
Feature 1                                                                                      
P0C6V0    2442 LFVFVANMLPAFTLLRFYIVVTAMYKVYCLCRHVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFCT 2521 Murine hepatitis...
ANJ04970  2355 LLVSLANMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMIRYYDVMANGGTGFCS 2434 Bovine coronavirus
QEY10622  2355 LLVSLANMLPAHVFMRFYIIIASFIKLFSLFGHVAYGCSKPGCLFCYKRNRSLRVKCSTIVGGMIRYYDVMANGGTGFCS 2434 Dromedary camel ...
ANJ04725  2355 LLVSLANMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKPGCLFCYKRNRSLRVKCSTIVGGMIRYYDVMANGGTGFCS 2434 Betacoronavirus 1
AQT26494  2355 LLVFLANMLPAHVFMRFYIIIASFIKLFSLCRHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMIRYYDVMANGGTGFCS 2434 Canine respirato...
BAS18843  2393 LLVSLANMLPAHVFMRFYIIIASFIKLFSLFRHVAYGCSKPGCLFCYKRNRSLRVKCSTIVGGMIRYYDVMANGGTAFCS 2472 Equine coronavirus
QEY10662  2353 LLVSLANMLPAHVFMRFYIIIASFIKLFSLFGHVAYGCSKPGCLFCYKRNRSLRVKCSTIVGGMIRYYDVMANGGTGFCS 2432 Dromedary camel ...
P0C6X6    2355 LLVALANMLPAHVFMRFYIIIASFIKLFSLFKHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMIRYYDVMANGGTGFCS 2434 Human coronaviru...
AIV41996  2355 LLVALANMLPAHVFMRFYIIIASFIKLFSLFKHVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMIRYYDVMANGGTGFCS 2434 Human coronaviru...
AZU96324  2355 LLVSLANMLPADVFMRFYIIIASFIKLFILFRYVAYGCSKSGCLFCYKRNRSLRVKCSTIVGGMIRYYDAMANGGTGFCS 2434 Yak coronavirus
Feature 1                                                                                      
P0C6V0    2522 KHQWNCLNCNSWKPGNTFITHEAAADLSKELKRPVNPTDSAYYSVTEVKQvgCSMRLFYERDGQRvYDDVNASLFVDMNG 2601 Murine hepatitis...
ANJ04970  2435 KHQWNCIDCDSYKPGNTFITVEAAFDLSKELKRPIQPTDVAYHTVTDVKQvgCYMRLFYDRDGQRtYDDVNASLFVDYSN 2514 Bovine coronavirus
QEY10622  2435 KHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVTDVKQvgCYMRLFYDRDGQRtYDDVNASLFVDYSN 2514 Dromedary camel ...
ANJ04725  2435 KHQWNCIDCDSYKPGNTFITVEAAFDLSKELKRPIQPTDVAYHTVTDVKQvgCYMRLFYERDGQRtYDDVNASLFVDYSN 2514 Betacoronavirus 1
AQT26494  2435 KHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVTDVKQvgCYMRLFYDRDGQRiYDDVNASLFVDYSN 2514 Canine respirato...
BAS18843  2473 KHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVTDVKQvgCYMRLFYERDGQRtYDDVNASLFVDYSN 2552 Equine coronavirus
QEY10662  2433 KHQWNCIDCDSYKPGNTFITVETALDLSKELKRPIQPTDVAYHTVTDVKQvgCYMRLFYERGGQRiYDDVNASLFVDYSN 2512 Dromedary camel ...
P0C6X6    2435 KHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVTDVKQvgCSMRLFYDRDGQRiYDDVNASLFVDYSN 2514 Human coronaviru...
AIV41996  2435 KHQWNCIDCDSYKPGNTFITVEAALDLSKELKRPIQPTDVAYHTVTDVKQvgCSMRLFYDRDGQRiYDDVNASLFVDYSN 2514 Human coronaviru...
AZU96324  2435 KHPWNCIDCDSYKPGNTFITVEAAFDLSNELKRPIQPTDVAYHTVTDVKQvgCYMRLFYDRDGQRtYDDVNASLFVDYSN 2514 Yak coronavirus
Feature 1                                                                                      
P0C6V0    2602 LLHSKVKGVPetHVVVVENEADKAGFLGAAVFYAQSLYRPMLMVEKKLITTANTGLSVsrTMFDLYVDSLLNVLDVDRKS 2681 Murine hepatitis...
ANJ04970  2515 LLHSKVKSVPnmHVVVVENDADKANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVteTMFDVYVDTFLSMFDVDKKS 2594 Bovine coronavirus
QEY10622  2515 LLHSKVKGVPnmHVVVVENDADKANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVteTMFDVYVDTFLSMFDVDKKS 2594 Dromedary camel ...
ANJ04725  2515 LLHSKVKGVPnmHVVVVESDADKANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVteTMFDVYVDTFLSMFDVDKKS 2594 Betacoronavirus 1
AQT26494  2515 LLHSKVKSVPnmHVVVVENDADKANFLNAVVFYAQSLFRPILMVDKNLITTANTGTSVteTMFDVYVDTFLSMFDVDKKS 2594 Canine respirato...
BAS18843  2553 LLHSKVKGVPnmHVVVVENDADKANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVteTMFDVYVDTFLSMFDVDKKS 2632 Equine coronavirus
QEY10662  2513 LLHSKVKGVPnmHVVVVENDADKANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVteTMFDVYVDTFLSMFDVDKKS 2592 Dromedary camel ...
P0C6X6    2515 LLHSKVKSVPnmHVVVVENDADKANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVteTMFDVYVDTFLSMFDVDKKS 2594 Human coronaviru...
AIV41996  2515 LLHSKVKSVPnmHVVPLENDADKANFLNAAVFYAQSLFRPILMVDKNLITTANTGTSVtkTMFDVYVDTFLSMFDVDKKS 2594 Human coronaviru...
AZU96324  2515 LLHSKLKSVPnmHVVVVENDSDKANFHNAAVFYAQSLFRPILMVDKNLKTTANTGTSVteTMFDVYVDTFLSMFDVDKKS 2594 Yak coronavirus
Feature 1                                                                                      
P0C6V0    2682 LTSFVNAAHNSLKEGVQLEQVMDTFIGCARRKCAIDSDVETKSITKSVMsaVNAGVDFTDESCNNLVPTYVKSDTIVAAD 2761 Murine hepatitis...
ANJ04970  2595 LNALIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMsaVAAGLELTDESCNNLVPTYLKGDNIVAAD 2674 Bovine coronavirus
QEY10622  2595 LNALIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMsaVSAGLELTGESCNNLVPTYLKGDNIVAAD 2674 Dromedary camel ...
ANJ04725  2595 LNALIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMsaVSAGLELTDESCNNLVPTYLKGDNIVAAD 2674 Betacoronavirus 1
AQT26494  2595 LNALIATAHSSIKQGTQIYKVLDTFLSCARKSCFIDSDVDTKCLVDSVMsaVSAGLELTDESCNNLVPTYLKGDNIVAAD 2674 Canine respirato...
BAS18843  2633 LNALIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMaaVSAGLELTDESCNNLVPTYLKSDNILAAD 2712 Equine coronavirus
QEY10662  2593 LNALIATAHSSIKQGTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMsaVSAGLELTDESCNNLVPTYLKGDNIVAAD 2672 Dromedary camel ...
P0C6X6    2595 LNALIATAHSSIKQGTQIYKVLDTFLSCARKSCSIDSDVDTKCLADSVMsaVSAGLELTDESCNNLVPTYLKSDNIVAAD 2674 Human coronaviru...
AIV41996  2595 LNALIATAHSSIKQGTLIYKVLDTFLTCARKSCSIDSDVDTNCLADSVMsaVSAGLELTDESCNNLVPTYLKSDNIVAAD 2674 Human coronaviru...
AZU96324  2595 LHALIATPHSSIKQDTQICKVLDTFLSCARKSCSIDSDVDTKCLADSVMsaVAAGLEMTDESCNNLVPTYLKGDNIVAAD 2674 Yak coronavirus
Feature 1                                                                                 
P0C6V0    2762 LGVLIQNNAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKACSKTGLKIKLTYNKQEANVPILTTPFSLKG 2836 Murine hepatitis viru...
ANJ04970  2675 LGVLIQNSAKHVQGNVAKIAGISCIWSVDAFNQLSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2749 Bovine coronavirus
QEY10622  2675 LGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2749 Dromedary camel coron...
ANJ04725  2675 LGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2749 Betacoronavirus 1
AQT26494  2675 LGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFSQLSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2749 Canine respiratory co...
BAS18843  2713 LGVLIQNFAKHVQGNVAKIAGVSCIWSVDAFNQLSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2787 Equine coronavirus
QEY10662  2673 LGVLIQNSAKHVQGNVAKIAGVSCIWFVDAFNQLSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2747 Dromedary camel coron...
P0C6X6    2675 LGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQFSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2749 Human coronavirus OC43
AIV41996  2675 LGVLIQNSAKHVQGNVAKIAGVSCIWSVDAFNQFSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2749 Human coronavirus OC43
AZU96324  2675 LGVLIQNSAKHVEGNVAKIAGVSCIWSVDAFNQLSSDFQHKLKKACCKTGLKLKLTYNKQMANVSVLTTPFSLKG 2749 Yak coronavirus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap