2LLM,6IYC,2LP1,2LOH


Conserved Protein Domain Family
JMTM_APP

?
cd21707: JMTM_APP 
juxtamembrane and transmembrane (JMTM) domain found in amyloid-beta precursor protein (APP) and similar proteins
Amyloid-beta precursor protein (APP), also called APPI, ABPP, Alzheimer disease amyloid protein, amyloid precursor protein, amyloid-beta A4 protein, cerebral vascular amyloid peptide (CVAP), PreA4, or protease nexin-II (PN-II), functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Amyloid-beta peptides are lipophilic metal chelators with metal-reducing activity; they bind transient metals such as copper, zinc and iron. This model corresponds to juxtamembrane and transmembrane (JMTM) domain of APP, which consists of the intact transmembrane (TM) domain with adjacent N-terminal juxtamembrane (JM) region. More than half of all familial APP mutations of Alzheimer's disease are seen in its JMTM domain region.
Statistics
?
PSSM-Id: 411990
Aligned: 10 rows
Threshold Bit Score: 41.8598
Created: 27-Apr-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
homodimerpolypeptide
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:homodimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        #              #  ##  ## ##  ## ##  #   
2LLM_A         4 KLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 43  human
6IYC_E         1 MLVFFAEDCGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 40  human
2LP1_A        17 KLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 56  human
2LOH_A         4 KLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 43  human
XP_006011468 559 KLVFFAEDVGSNKGAIIGLMVGGIVIATVIVITLVMLRKK 598 coelacanth
NP_989639    668 KLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 707 chicken
NP_001082098 666 KLVFFAEEVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 705 African clawed frog
XP_007901748 624 KLVFFPEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 663 elephant shark
O73683       697 KLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLRKK 736 green pufferfish
P05067       687 KLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK 726 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap