Conserved Protein Domain Family
RRM3_Crp79_Mug28

?
cd21622: RRM3_Crp79_Mug28 
RNA recognition motif 3 (RRM3) found in Schizosaccharomyces pombe mRNA export factor Crp79, meiotically up-regulated gene 28 protein (Mug28) and similar proteins
Crp79, also called meiotic expression up-regulated protein 5 (Mug5), or polyadenylate-binding protein crp79, or PABP, or poly(A)-binding protein, is an auxiliary mRNA export factor that binds the poly(A) tail of mRNA and is involved in the export of mRNA from the nucleus to the cytoplasm. Mug28 is a meiosis-specific protein that regulates spore wall formation. Members in this family contain three RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). The model corresponds to the three RRM motif.
Statistics
?
PSSM-Id: 410201
Aligned: 8 rows
Threshold Bit Score: 172.938
Created: 25-Feb-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9P6M8        379 IDPSNLYVKNLDDTVITCKSQLEDLFSPFGSILSSMLACYPN----SGISKGYGFVAFRQIEAAVRAKDTLNGMMVGKKR 454  fission yeast
Q9UT83        416 IDPCNLFVKNLDDNIVGNTQQLEELFSKFGRIKSCTLASYPS----TEISKGYGFVSFSHPFEAVQAINTLNGVLFGKKR 491  Schizosacchar...
RPA87097        2 YDPANLHVKNLDDTRITNTEDLKNLFAGYGQIASAVLVAYPN----SGISKGFGFVAFTTPADAAKAKANLNGMVVGRKP 77   Ascobolus imm...
XP_002172720  289 EDPCNVFVKNLDDKLIYSKTLLEQLFEPFGHITSSCLPCIPD----TDIPKGYGFVAFSKPEEAFSAITRMNGVVVGEKR 364  Schizosacchar...
CCJ29950      357 ADPKNLYIKNLDDDIISHPSDIETLFKPYGTIVSSHLAVVPG----TGISKGYGFVAFSKAEEAIKAKKSLDGSMVGRKR 432  Pneumocystis ...
CCX09203      540 VDPCNLFVKNLDDTIVGTSEDLQKLFEAFGAVASAHLATFNE----SKISKGFGFVAFKDPMDAAKAKEKMNNSLVGRKR 615  Pyronema omph...
OLL23749      329 INPCNLYVKNLDDEVVENQEQLKNFFSKYGQIVSCYLATVSG----TGISRGFGFVMFSRSEDALAAKEALDSQIVGKKR 404  Neolecta irre...
XP_019025240  624 VDPCNLFVKNLDDDVVASKMDLDQLFGSFGTVSSSYLAVYPSngsnVGLSRGFGFVSFLNPADAARARGEMDGKMIGRKR 703  Saitoella com...
Q9P6M8        455 IFVCFAERKSDRIRRL 470  fission yeast
Q9UT83        492 LFVNYAEKREDRKKRL 507  Schizosaccharomyces pombe 972h-
RPA87097       78 IVINYAERKEDRRQRL 93   Ascobolus immersus RN42
XP_002172720  365 IFVCFAESREQRSKRL 380  Schizosaccharomyces japonicus yFS275
CCJ29950      433 VFVSWAERRADREKRL 448  Pneumocystis jirovecii
CCX09203      616 VFVSYAERKEDRAKRL 631  Pyronema omphalodes CBS 100304
OLL23749      405 LFVSYAESKEKREQRL 420  Neolecta irregularis DAH-3
XP_019025240  704 IFVSWAEKKEDRMKRL 719  Saitoella complicata NRRL Y-17804
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap