6EZ7,5D78,5D77


Conserved Protein Domain Family
RRM3_PES4_MIP6

?
cd21603: RRM3_PES4_MIP6 
Click on image for an interactive view with Cn3D
RNA recognition motif 3 (RRM3) found in Saccharomyces cerevisiae protein PES4, protein MIP6 and similar proteins
The family includes PES4 (also called DNA polymerase epsilon suppressor 4) and MIP6 (also called MEX67-interacting protein 6), both of which are predicted RNA binding proteins that may act as regulators of late translation, protection, and mRNA localization. MIP6 acts as a novel factor for nuclear mRNA export, binds to both poly(A)+ RNA and nuclear pores. It interacts with MEX67. Members in this family contain four RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). The model corresponds to the third RRM motif.
Statistics
?
PSSM-Id: 410182
Aligned: 16 rows
Threshold Bit Score: 108.142
Created: 19-Feb-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6EZ7_A      2 NSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVKY-LWAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVT 74   Saccharomyces cerevisia...
P39684    303 NSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVKY-LWAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVT 375  Saccharomyces cerevisia...
QGN13765  480 NAVFVKNLPINPNHDSLLNFFSKVGPVKSVYTSDVSKFES-SWAFITYKRIQDTKVAIEKLNGSKYMKRTIEVK 552  Kluyveromyces marxianus
KTA99966  276 NGIFIKNLPLDTNNNEILTIFSEVGPIKSVFLSPLNESREyLWAFVTYKDKASVEKAISLFNGKAIGNRNVFVT 349  [Candida] glabrata
SCU90973  304 NSVHVKNLPIEADNEMLLDFFSKVGPVKSIFTARSKTHKNsCWGFVTYKKGRDTQKALVALNGMLFIGKKLTIT 377  Lachancea meyersii CBS ...
CUS21005  305 NSVHVKNLPVGVCNEDLLNYFSKVGPIKSVFTSKVDVYTA-SWGFITYKRGKDTIRALEELNGVIFMGKRIEVT 377  Lachancea quebecensis
NP_984845 325 NAVFIKNLPLNPDSDLLLDYFSQIGPVKSIFTSNVSKLNS-AWAFITFKKGSDAQDAIDNLNHSQLLGRTIELS 397  Eremothecium gossypii A...
5D78_A      7 KTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTP-HKAFVTYKNEEESKKAQKXLNKTIFKNHTIWVG 79   Saccharomyces cerevisia...
OBA26093  218 NAIYIIGLPKSCNNDVTLDLFSRAGPIKSVHTCPKYSSNY-RYAYITFKKGSDCQKAIQMFDNKLVKGRLVRAC 290  Hanseniaspora valbyensi...
5D77_A      7 KTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTP-HKAFVTYKNEEESKKAQKXLNKTIFKNHTIWVG 79   Saccharomyces cerevisia...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap