Conserved Protein Domain Family
SARS-CoV-2_Orf10
?
cd21597: SARS-CoV-2_Orf10 
Severe acute respiratory syndrome coronavirus 2 Orf10
This model represents the Orf10 protein of Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), also known as 2019 novel coronavirus (2019-nCoV). SARS-CoV-2 causes the disease called "coronavirus disease 2019" (COVID-19). Orf10 appears to have no homologous proteins in SARS-CoV and other coronaviruses. It has been suggested that the genome sequence currently annotated as orf10 may not have a protein coding function in SARS-CoV-2, and instead may act, itself or as a precursor of other RNAs, in the regulation of gene expression, replication, or modulating cellular antiviral pathways (DOI:10.1101/2020.03.05.976167).
Links
?
Statistics
?
PSSM-Id: 394948
Aligned: 3 rows
Threshold Bit Score: 51.8849
Created: 29-Apr-2020
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
YP_009725255  1 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFN 36  Severe acute respiratory syndrome coronavirus 2
QIM47465      1 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFN 36  Severe acute respiratory syndrome coronavirus 2
QIS29991      1 MGYINIFAFPFTIYSLLLCRMNSRNYIAQVDVVNFN 36  Severe acute respiratory syndrome coronavirus 2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap