Conserved Protein Domain Family
SUN1_cc1

?
cd21439: SUN1_cc1 
coiled-coil domain 1 of SUN domain-containing protein 1 and similar proteins
SUN domain-containing protein 1 (SUN1), also called protein unc-84 homolog A, or Sad1/unc-84 protein-like 1, is a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex which is involved in the connection between the nuclear lamina and the cytoskeleton. Besides the core SUN domain, SUN1 contains two coiled-coil domains (CC1 and CC2), which act as the intrinsic dynamic regulators for controlling the activity of the SUN domain. This model corresponds to CC1 that may function as an activation segment to release CC2-mediated inhibition of the SUN domain.
Statistics
?
PSSM-Id: 410605
Aligned: 27 rows
Threshold Bit Score: 58.4452
Created: 18-Mar-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putative trimer
Feature 1:putative trimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structure evidence that Mus musculus SUN domain-containing protein 2 forms a homotrimer

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        #  ##  #  ##  ## ##  ## ##  ## ##  #  ##  #  ##  ## ###
O94901       444 QPPRETDFMAFHQEHEVRMSHLEDILGKLREKSEAIQKELEQTKQKTISAVGEQL 498  human
XP_007498355 559 ISSSKTDFLAFHQEHELRILKLEDLLGKLSEKSKIIQEELDQTKSRTFSGIDEQQ 613  gray short-tailed opossum
XP_016081038 563 TSDSKADYMAFYQKHELRILKLEDLLGKISEKSEVIQKELEQAKSRTISEGYEHQ 617  platypus
XP_020664345 547 ATQPTHDFLALHQEHEWRIVALEDLLSKLSEKSEGIQKELELTKAKTSSDRDEQN 601  central bearded dragon
KGL86592     497 KLEEKTDFLALHQEHELRILTLEDLLGKLSAESKDIQKELDIAKAKTVRDADEHT 551  killdeer
XP_030068061 514 KPNETTDTMAFHQEHDLRIMKLEDLLGKLSAKSEELQIEMDLTKARIARGDDEKD 568  Microcaecilia unicolor
XP_005997026 551 MDLTQNDFMAWHQDHESRIRELEELLRKLSVRSEEVSMDLKMAKASTTSENDEQN 605  coelacanth
XP_029432950 505 KPDGVADTVAIHQEYNLRVLKLEELLGKLSIKSEELQKEMEQTRSRIVRGGDEQD 559  two-lined caecilian
TFJ99935     531 KMAHSTTDLALHQEHELRILTLEDLIGKLSAKSEDIQKELELTQKRTVSGSDEQN 585  big-headed turtle
XP_004598223 448 QQLQEADFMTLHQEHEVRLSALEGILGELAERAEAFQKELQEAKLAAASEEQQHL 502  American pika

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap