Conserved Protein Domain Family
GAT_STAM2

?
cd21390: GAT_STAM2 
non-canonical GAT domain found in signal transducing adapter molecule 2 (STAM-2) and similar proteins
STAM-2 is a Hrs-binding protein involved in intracellular signal transduction mediated by cytokines and growth factors. STAM-2 is a component of the ESCRT-0 complex that binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them for further sequential lysosomal sorting/trafficking processes. Members of this family contain a non-canonical GAT (GGA and Tom1) domain consisting of two helices. A canonical GAT domain is a monomeric three-helix bundle that bind to ubiquitin. STAM-2, together with another GAT domain-containing protein Hrs, forms a Hrs/STAM2 core complex that consists of two intertwined GAT domains, each consisting of two helices from one subunit, and one from the other subunit. The two GAT domains are connected by a two-stranded coiled-coil. The Hrs/STAM2 complex, an intertwined GAT heterodimer, is a scaffold for binding of ubiquitinated cargo proteins and coordinating ubiquitination and deubiquitination reactions that regulate sorting.
Statistics
?
PSSM-Id: 410595
Aligned: 6 rows
Threshold Bit Score: 156.205
Created: 6-Feb-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putative
Feature 1:putative heterodimer interface [polypeptide binding site]
Evidence:
  • Comment:The STAM/Hrs complex is a GAT domain-based scaffold for ubiquitin-dependent sorting.
  • Comment:Based on the structure evidence that Homo sapiens STAM1 forms a complex with Hrs.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              # #  ## ##  #  # ## #  #   #   #  ##  ## ###### ### ## ######## ### ##  ##
O75886       286 EPEPVYIDEDKMDRALQVLQSIDPTDSkPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALELYNKLV 365 human
O93436       285 EPEAVYIDEDKMDKTLQVLQSIDPTDL-NLDTDLLDSEVICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALELYNKLM 363 chicken
XP_014347526 296 EPESVYIDEEKMDRTLHLLQSADPTVSmPDPPELLNLEDICQQMGPMIDERLEEIDRKHSELSELNVKVLEALELYNKLM 375 coelacanth
NP_001007370 287 EPEPVYIDEEKMDKTLYLLQNTDPADAtPDGPELLTLEDACEKMNPLIDEKLQEIDRKHSELSELNVKVLEALELYNQLM 366 zebrafish
XP_007907456 293 EPEPVYIDEEKMNQVLQLLQNADPTIQeLDSPGLLHLEDVCQQMGPIIDEKLEEIDRKHSELSELNVKVLEALELCNKLM 372 elephant shark
NP_001080429 279 EPEPVFIDESKMDQALQLLQSIDPTDPkPDSSALLDLEDVCQQMGPMIDERLEEIDRKHSELSELNVKVMEALQLYNKLM 358 African clawed ...
Feature 1         #         
O75886       366 NEAPVYSVYSK 376 human
O93436       364 NETPMYSAYSK 374 chicken
XP_014347526 376 NEAPMYSVYSK 386 coelacanth
NP_001007370 367 NEAPLYNAYSK 377 zebrafish
XP_007907456 373 NDVPMYSSMYS 383 elephant shark
NP_001080429 359 NEAPMYSVYSK 369 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap