Conserved Protein Domain Family
cwf21_SRRM2

?
cd21375: cwf21_SRRM2 
cwf21 domain found in serine/arginine repetitive matrix protein 2
Serine/arginine repetitive matrix protein 2 (SRRM2) is also called 300 kDa nuclear matrix antigen, serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa, SR-related nuclear matrix protein of 300 kDa, Ser/Arg-related nuclear matrix protein of 300 kDa, splicing coactivator subunit SRm300, or Tax-responsive enhancer element-binding protein 803 (TaxREB803). It is required for pre-mRNA splicing as component of the spliceosome. It contains a cwf21 domain at the N-terminus. The cwf21 domain is involved in mRNA splicing; it binds directly to the spliceosomal protein Prp8.
Statistics
?
PSSM-Id: 410601
Aligned: 4 rows
Threshold Bit Score: 103.172
Created: 10-Feb-2020
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9UQ35         39 EEELRRLEAALVKRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKD 102  human
XP_014346848   38 EEELKRLESLLVKKPNQDILDHERKRKVELKCLELEEMMEEQGYSEGEIQEKVATFRQMLIEKE 101  coelacanth
XP_018092227   38 EEELKKLENLLMKKPNQDILDHERKRKVELKCLELEEMMAEQGYNDAEIQEKVATFRLMLQEKD 101  African clawed frog
TRZ08929       41 EEELRRLEAALAKKPNPDILDHQRKRRVELKCLELAELMEEQGYSGEEIEAKVATFRTMLLEKD 104  Zosterops borbonicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap