6ES4


Conserved Protein Domain Family
NURR_Syncrip-like

?
cd21065: NURR_Syncrip-like 
NURR (N-terminal unit for RNA recognition) domain found in Drosophila melanogaster Syncrip and similar proteins
Syncrip is a conserved RNA-binding protein important in neuronal and muscular development in Drosophila. It is essential for the morphology and growth of the neuromuscular junction and regulates cytoplasmic vesicle-based messenger RNA (mRNA) transport. The model corresponds to NURR domain of Syncrip, which is a RNA-binding domain with a highly conserved RNA-binding surface.
Statistics
?
PSSM-Id: 410953
Aligned: 8 rows
Threshold Bit Score: 161.876
Created: 30-Nov-2018
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6ES4_A         5 EDYPKLLEYGLDKKVAGKLDEIYKTGKLAHAELDERALDALKEFPVDGALNVLGQFLESNLEHVSNKSAYLCGVMKTYRQ 84  fruit fly
EFX79643      19 EEYHRLIELGLDRRVAGKLEEIYRTGKLVHSELDDRALDALKEFPVDGAQSVLQQFLESNLEHVSNKSAFLCGIMKTYRQ 98  common water flea
OQR69830      23 PDYQKLISHGLNQAVATQLDDIFKTGKLAYTDLDERALDALKEFPQDGALTVLKQFLDSSLEHVSNKSAFLCGIMKTYRQ 102 Tropilaelaps me...
XP_013416723  28 EGYQKLVDYGIDQKVAEELDKVYQTETVCHDDLDERALDALKEFNVEGALEVIKEFCTSNLEHVTNKSAYLCGVMKTYRQ 107 Lingula anatina
ELU17586      28 EDYDKLIEYGINAKVAEELDDIYKSGILSHGDLDERALDALKEFPAEDGIGVLKEFQCSNLDHVSNKSAFLCGVMKTYRQ 107 Capitella teleta
ABP04054      27 EDFQKLTEYGINIKVANELVKIYESGKLAHADLDERALDALKELNADDAIAVLKQFCESSLEHVGNKSAFLCGMMKTYRQ 106 Pinctada fucata
NP_001262778  60 EDYPKLLEYGLDKKVAGKLDEIYKTGKLAHAELDERALDALKEFPVDGALNVLGQFLESNLEHVSNKSAYLCGVMKTYRQ 139
EEC05748      31 PDYAKLLGHGLQEKVAAQLDAIFQTGKLAYADLDERALDALKEFPADGALAVLKQFLDSSLEHVSNKSAYLCGVMKTYRQ 110 black-legged tick
6ES4_A        85 KSR 87  fruit fly
EFX79643      99 KVR 101 common water flea
OQR69830     103 KSK 105 Tropilaelaps mercedesae
XP_013416723 108 RMK 110 Lingula anatina
ELU17586     108 KNK 110 Capitella teleta
ABP04054     107 NKK 109 Pinctada fucata
NP_001262778 140 KSR 142
EEC05748     111 KSK 113 black-legged tick
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap