1A9E,1A1M,1A1N,1A9B,1E27,1E28,1AGB,1AGC,1AGD,1AGE,1AGF,1MI5,1HSA,1JGE,1K5N,1A1O,6AT5


Conserved Protein Domain Family
IgC1_MHC_Ia_HLA-B

?
cd21026: IgC1_MHC_Ia_HLA-B 
Click on image for an interactive view with Cn3D
Class Ia major histocompatibility complex (MHC) immunoglobulin domain of human leukocyte antigen (HLA) B and similar proteins; member of the C1-set of Ig superfamily (IgSF) domains
The members here are composed of the class Ia major histocompatibility complex (MHC) immunoglobulin domain of human leukocyte antigen (HLA) B and similar proteins. The classical class I molecules (HLA-A, -B, and -C) are responsible for the presentation of endogenous antigen to CD8+ T cells. The receptor is a heterodimer, and is composed of a heavy alpha chain and smaller beta chain. The alpha chain is encoded by a variant HLA-B gene, and the beta chain (beta-2-microglobulin) is an invariant beta-2-microglobulin molecule. The beta-2-microglobulin protein is coded for by a separate region of the human genome. Human leukocyte antigen (HLA) B*3501 (B35) is a common human allele involved in mediating protective immunity against HIV. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes. Class I molecules consist of a transmembrane alpha chain and a small chain called the beta-2-microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3). Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading. Class I MHC molecules are expressed on most nucleated cells.
Statistics
?
PSSM-Id: 409617
Aligned: 54 rows
Threshold Bit Score: 205.048
Created: 13-Mar-2019
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #         # # #                        ## ####    # #               
1A9E_A    180 QRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 259 human
1AGC_A    180 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 259 human
1AGD_A    180 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 259 human
1AGE_A    180 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 259 human
1AGF_A    180 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 259 human
1MI5_A    180 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 259 human
6AT5_A    204 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 283 human
P30460    204 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 283 human
P30480    204 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTC 283 human
P30486    204 ERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVVPSGEEQRYTC 283 human
Feature 1                      
1A9E_A    260 HVQHEGLPKPLTLRWEP 276 human
1AGC_A    260 HVQHEGLPKPLTLRWEP 276 human
1AGD_A    260 HVQHEGLPKPLTLRWEP 276 human
1AGE_A    260 HVQHEGLPKPLTLRWEP 276 human
1AGF_A    260 HVQHEGLPKPLTLRWEP 276 human
1MI5_A    260 HVQHEGLPKPLTLRWEP 276 human
6AT5_A    284 HVQHEGLPKPLTLRWEP 300 human
P30460    284 HVQHEGLPKPLTLRWEP 300 human
P30480    284 HVQHEGLPKPLTLRWEP 300 human
P30486    284 HVQHEGLPKPLTLRWEP 300 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap