3ZD0,2M6X,2MTS


Conserved Protein Domain Family
HCV_p7

?
cd20903: HCV_p7 
Hepatitis C virus p7 protein
Hepatitis C virus (HCV) p7 protein is a viroporin essential for virus production. The p7 monomer is comprised of 2 trans-membrane helices connected by a cytosolic loop, and oligomerizes to form cation-specific ion channels. These ion channels dissipate pH gradients in secretory vesicles potentially protecting acid-labile intracellular virions during egress (the rupturing of the infected cell and release of viral contents). p7 protein has at least two different functions in culture, one via the formation of these ion channels, the other through its specific interaction with the non-structural viral protein NS2. Several compounds targeting p7 have been investigated as anti-HCV drugs.
Links
?
Statistics
?
PSSM-Id: 411017
Aligned: 36 rows
Threshold Bit Score: 61.8584
Created: 17-Aug-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 46 residues -Click on image for an interactive view with Cn3D
Feature 1:putative oligomer interface [polypeptide binding site]
Evidence:
  • Comment:both hexamer and heptamer have been proposed as the oligomeric state of p7; it has been suggested that in biological membranes p7 might exist as a mixture of oligomers with variable size
  • Structure:2MXC: Hepatitis C virus (isolate EUH1480) p7 channel hexamer interface, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ### ############# ############### ###### ## #  ### ##  #  
3ZD0_A      20 ALENLVVLNAASVAGAHGILSFLVFFCAAWYIKGRLAPGAAYAFYGVWPLLLLLLALP 77   Hepacivirus C
2M6X_A       1 GAKNVIVLNAASAAGNHGFFWGLLVVTLAWHVKGRLVPGATYLSLGVWPLLLVRLLRP 58   Hepatitis C virus (isolate EUH1480)
Q68798     751 ALENLIVLNAASAAATRGWECFLLFMCWAWYVRGRVVPAVTYGLLNLWPLLLLVLLLP 808  Hepatitis C virus (isolate JK046)
ACD14090   752 ALENLINLNAAAAAGIHGWVWGLVFICLAWHVRGRLAPAAAYGALQLWPLLLLVLALP 809  Hepacivirus C
ACL68400   747 ALANLINLNAMSAAGSHGAGYAFAFFCITWYIKGRLPAATAYAFCGLWPLLLLLLALP 804  Hepacivirus C
ACS29434   747 ALANMITINAMSAAGSHGPLCAIIFFCFAWYIKGRAPAAAVYAACGLWPLLLLLLALP 804  Hepacivirus C
AFD18583   746 ALANLITINAVSVSGHYGPGYAIAFICVAWYIKGRLPAAATYMMSGLWPLLLLLLALP 803  Hepacivirus C
AFN53798   747 ALANLVTINAISAVGTHGFHYAILFICVAWYVRGRLPAAAAYAACGMWPLFLLLLAMP 804  Hepatitis C virus subtype 4r
AII25857   752 ALENLVVLNAASAVGHHGLGWLLLFICWAWYVRGRMVPACAYGILQIWPLLLLILLLP 809  Hepacivirus C
AII25860   747 AMENLVRLNAASAAASQGWWWCLVFICCAWYVRGRLVPGVTYGLLQMWPLLLLLLALP 804  Hepacivirus C

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap