Conserved Protein Domain Family
C1_ARHGEF2

?
cd20877: C1_ARHGEF2 
protein kinase C conserved region 1 (C1 domain) found in Rho guanine nucleotide exchange factor 2 (ARHGEF2) and similar proteins
ARHGEF2, also called guanine nucleotide exchange factor H1 (GEF-H1), microtubule-regulated Rho-GEF, or proliferating cell nucleolar antigen p40, acts as guanine nucleotide exchange factor (GEF) that activates Rho-GTPases by promoting the exchange of GDP for GTP. It is thought to play a role in actin cytoskeleton reorganization in different tissues since its activation induces formation of actin stress fibers. ARHGEF2 may be involved in epithelial barrier permeability, cell motility and polarization, dendritic spine morphology, antigen presentation, leukemic cell differentiation, cell cycle regulation, innate immune response, and cancer. It contains a C1 domain followed by Dbl-homology (DH) and pleckstrin-homology (PH) domains which bind and catalyze the exchange of GDP for GTP on RhoA. This model corresponds to the C1 domain. The C1 domain is a cysteine-rich zinc binding domain that does not bind DNA nor possess structural similarity to conventional zinc finger domains; it contains two separate Zn(2+)-binding sites.
Statistics
?
PSSM-Id: 410427
Aligned: 6 rows
Threshold Bit Score: 122.382
Created: 7-Oct-2019
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
Zn binding site
Feature 1: Zn binding site [ion binding site], 8 residue positions
Conserved feature residue pattern:H C C C C H C CClick to see conserved feature residue pattern help
Evidence:
  • Comment:Two non-consecutive sets of zinc-binding residues form two separate metal-binding sites.
  • Comment:Based on the structure evidence that Rattus norvegicus ROCK2 binds two Zn2+ ions

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #            #  #           #  #    #  #      #         
Q92974         35 RYTNGHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQK 95   human
TRZ09893       46 RYTNGHLFTTISVSGMTMCFACNKSITAKEALVCPTCNVTIHNRCKDTLPNCTKVKQKQQK 106  Zosterops borbonicus
XP_006005168   75 RYTNGHLFNSITVSGLTQCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQK 135  coelacanth
OCT66627       59 RYTNGHLFTTITVSGTTMCFVCNKSITAKEALICPTCSVSIHNRCKDALPSCTKVKQKQQK 119  African clawed frog
NP_001075100   41 RYSNGHLFNCLTVSGTTLCSACNKSITAKEALSCPTCNVTIHNRCRDTLPNCVKMKQKQQK 101  zebrafish
XP_020788983   40 RGGSTHLFTSMTVSGTTMCSACSKRITAKEALNCALCGVTVHSHCQDGCPDCSKTKHRAKP 100  great blue-spotted mudskipper

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap