2ROW


Conserved Protein Domain Family
C1_ROCK2

?
cd20875: C1_ROCK2 
protein kinase C conserved region 1 (C1 domain) found in Rho-associated coiled-coil containing protein kinase 2 (ROCK2) and similar proteins
ROCK2 is a serine/threonine kinase, catalyzing the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. ROCK2, also called Rho-associated protein kinase 2, Rho kinase 2, Rho-associated, coiled-coil-containing protein kinase II (ROCK-II), or p164 ROCK-2, was the first identified target of activated RhoA, and was found to play a role in stress fiber and focal adhesion formation. It is prominently expressed in the brain, heart, and skeletal muscles. It is implicated in vascular and neurological disorders, such as hypertension and vasospasm of the coronary and cerebral arteries. ROCK2 is also activated by caspase-2 cleavage, resulting in thrombin-induced microparticle generation in response to cell activation. Mice deficient in ROCK2 show intrauterine growth retardation and embryonic lethality because of placental dysfunction. ROCK proteins contain an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD), a pleckstrin homology (PH) domain and a C1 domain. The C1 domain is a cysteine-rich zinc binding domain that does not bind DNA nor possess structural similarity to conventional zinc finger domains; it contains two separate Zn(2+)-binding sites.
Statistics
?
PSSM-Id: 410425
Aligned: 7 rows
Threshold Bit Score: 135.162
Created: 7-Oct-2019
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
Zn binding site
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1: Zn binding site [ion binding site], 8 residue positions
Conserved feature residue pattern:H C C C C H H CClick to see conserved feature residue pattern help
Evidence:
  • Comment:Two non-consecutive sets of zinc-binding residues form two separate metal-binding sites.
  • Structure:2ROW; Rattus norvegicus ROCK2 binds two Zn2+ ions.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    #            #  #               #  #    #  #          #     
2ROW_A         14 GEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD 84   Norway rat
O75116       1250 GEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD 1320 human
XP_005995983 1251 GEKSSYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCRVNYD 1321 coelacanth
RMC17261     1559 GEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD 1629 Hirundo rustica rustica
OCT78993     1234 LEKSNYICHKGHEFIPTLYHFPTSCDACMKPLWHMFKPPAALECRRCHIKCHKDHMDKKEEIIAPCKVNYD 1304 African clawed frog
NP_777288    1239 GDKSSYICHKGHEFIPTLYHFPTNCEACTKPLWNMFKPPPALECRRCHIKCHKDHMDKKEEVIAPCRVDMS 1309 zebrafish
XP_007895273 1244 GEKSSYIPHKGHEFIPTLYHFPTNCEACTKPLWHMFKPPPALECRRCHIKCHKDHMDRKEDLIAPCKVNYD 1314 elephant shark

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap