4L9M


Conserved Protein Domain Family
C1_RASGRP1

?
cd20860: C1_RASGRP1 
protein kinase C conserved region 1 (C1 domain) found in RAS guanyl-releasing protein 1 (RASGRP1) and similar proteins
RASGRP1, also called calcium and DAG-regulated guanine nucleotide exchange factor II (CalDAG-GEFII) or Ras guanyl-releasing protein, functions as a calcium- and diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cell/B-cell development, homeostasis and differentiation by coupling T-lymphocyte/B-lymphocyte antigen receptors to Ras. RASGRP1 also regulates NK cell cytotoxicity and ITAM-dependent cytokine production by activation of Ras-mediated ERK and JNK pathways. The C1 domain is a cysteine-rich zinc binding domain that does not bind DNA nor possess structural similarity to conventional zinc finger domains; it contains two separate Zn(2+)-binding sites.
Statistics
?
PSSM-Id: 410410
Aligned: 7 rows
Threshold Bit Score: 131.979
Created: 7-Oct-2019
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
Zn binding siteputative DAG/PE
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1: Zn binding site [ion binding site], 8 residue positions
Conserved feature residue pattern:H C C C C H C CClick to see conserved feature residue pattern help
Evidence:
  • Comment:Two non-consecutive sets of zinc-binding residues form two separate metal-binding sites.
  • Structure:4L9M; Homo sapiens RASGRP1 binds two Zn2+ ions.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #            #  #             #  #    #  #       #   
4L9M_A       492 FPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKR 546 human
Q6NTL4       536 FLHNFQETTYLRPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKELVVFECKKR 590 African clawed frog
XP_007886246 402 FHHNFQETTYMKPTFCDNCAGFIWGVIKQGYRCRDCGMNCHKQCRDLVVLECKNK 456 elephant shark
XP_005993023 491 FPHSFQETTYLKPTFCDNCAGFLWGVIKQGYRCRDCGMNCHKQCKDLVVFECKKK 545 coelacanth
O95267       540 FPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKR 594 human
RMC00424     373 FAHNFQETTYLRPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVIECKRR 427 Hirundo rustica rustica
RXM96723     396 FIHNFQETTYMKPTFCDNCAGFLWGVIKQGYRCRDCGMNCHKQCKDLVAFECKKN 450 sterlet

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap