Conserved Protein Domain Family
C1_DGKbeta_rpt1

?
cd20845: C1_DGKbeta_rpt1 
first protein kinase C conserved region 1 (C1 domain) found in diacylglycerol kinase beta (DAG kinase beta) and similar proteins
Diacylglycerol (DAG) kinase (EC 2.7.1.107) is a lipid kinase that phosphorylates diacylglycerol to form phosphatidic acid. DAG kinase beta, also called 90 kDa diacylglycerol kinase, or diglyceride kinase beta (DGK-beta), exhibits high phosphorylation activity for long-chain diacylglycerols. It is classified as a type I DAG kinase (DGK), containing EF-hand structures that bind Ca(2+) and a recoverin homology domain, in addition to C1 and catalytic domains that are present in all DGKs. As a type I DGK, it is regulated by calcium binding. DAG kinase beta contains two copies of the C1 domain. This model corresponds to the first one. DGK-beta contains typical C1 domains that bind DAG and phorbol esters. The C1 domain is a cysteine-rich zinc binding domain that does not bind DNA nor possess structural similarity to conventional zinc finger domains; it contains two separate Zn(2+)-binding sites.
Statistics
?
PSSM-Id: 410395
Aligned: 15 rows
Threshold Bit Score: 141.142
Created: 7-Oct-2019
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
Zn binding siteputative DAG/PE
Feature 1: Zn binding site [ion binding site], 8 residue positions
Conserved feature residue pattern:H C C C C H C CClick to see conserved feature residue pattern help
Evidence:
  • Comment:Two non-consecutive sets of zinc-binding residues form two separate metal-binding sites.
  • Comment:Based on the structure evidence that Homo sapiens DGKdelta binds two Zn2+ ions

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                #            #  #             #  #    #  #       #         
Q9Y6T7        238 NVKDDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSKR 303  human
Q01583        376 TLKEDGIHVWRLKHFSKPAYCNLCLNMLVGLGKKGLCCVLCKYTVHERCVQHAPASCITTYVKSKK 441  fruit fly
OCT74047      234 NVKDDGQHVWRLKHFNKPAYCNLCLNMLIGLGKQGLCCSFCKYTVHERCVSRAPPSCIKTYVKSKK 299  African clawed frog
XP_006821216  158 NVKDDGNHVWRLKHYNRPAYCNLCLNMLVGLGKQGLSCTFCKYTVHERCVQRAPPSCISTYVKSKR 223  Saccoglossus kowalevskii
XP_002606233  215 VIKDDGNHIWRLKHFNKPAFCNLCLNMLMGLGKQGLSCTFCKYTVHERCVQRAPGSCISTYTKSKR 280  Florida lancelet
XP_013400270  226 NVKDDGQHVWRLKHFNKPAYCNLCLNLLVGLGKQGLSCTFCKYTVHERCVHRAPASCITTYVKSKK 291  Lingula anatina
PVD37197      381 NVQDDGTHVWRLKHFNRPAYCNLCLNMLVGLGKQGLCCTFCKYTVHERCVQRAPASCITTYVKSKK 446  Pomacea canaliculata
XP_011664499  418 NVKDDGSHVWRLKHYNKPAYCNLCLNLLVGFGKQGLSCTFCKYTVHERCVQRAPACCISTYVKSKR 483  purple sea urchin
EFX72450      146 NVKEDGNHLWRLKHFNRPAYCNLCLNMLVGLGKKGLCCIFCKYTVHERCVQRAPASCICTYVKSKK 211  common water flea
EEC19081      117 NVKDDGNHVWRLKHFNRPAYCNLCLNMLVGLGKKGLCCVFCKYTVHERCVQRAPASCINTYVKSKK 182  black-legged tick

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap