Conserved Protein Domain Family
C1_PKD3_rpt1

?
cd20841: C1_PKD3_rpt1 
first protein kinase C conserved region 1 (C1 domain) found in protein kinase D3 (PKD3) and similar proteins
PKD3 is also called PRKD3, PRKCN, serine/threonine-protein kinase D3 (nPKC-D3), protein kinase C nu type (nPKC-nu), or protein kinase EPK2. It converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. It is involved in the regulation of the cell cycle by modulating microtubule nucleation and dynamics. PKD3 acts as a key mediator in several cancer development signaling pathways. PKD3 contains N-terminal tandem cysteine-rich zinc binding C1 (PKC conserved region 1), central PH (Pleckstrin Homology), and C-terminal catalytic kinase domains. This model corresponds to the first C1 domain. The C1 domain is a cysteine-rich zinc binding domain that does not bind DNA nor possess structural similarity to conventional zinc finger domains; it contains two separate Zn(2+)-binding sites.
Statistics
?
PSSM-Id: 410391
Aligned: 5 rows
Threshold Bit Score: 165.985
Created: 7-Oct-2019
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
Zn binding siteputative DAG/PE
Feature 1: Zn binding site [ion binding site], 8 residue positions
Conserved feature residue pattern:H C C C C H C CClick to see conserved feature residue pattern help
Evidence:
  • Comment:Two non-consecutive sets of zinc-binding residues form two separate metal-binding sites.
  • Comment:Based on the structure evidence that Caenorhabditis elegans Dkf-1 binds two Zn2+ ions

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #            #  #             #  #    #  #       #               
O94806       145 ATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPG 219 human
KAA0711526   144 ATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPG 218 Triplophysa tibetana
KFV97688     146 ATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPG 220 sunbittern
XP_030053927 137 ATVEDFQIRPHALFVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVKKRRLSNVSLPG 211 Microcaecilia unicolor
XP_007896673 175 ATVEDFQIRPHALYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPG 249 elephant shark

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap