2IVX


Conserved Protein Domain Family
CYCLIN_CCNT2_rpt2

?
cd20598: CYCLIN_CCNT2_rpt2 
Click on image for an interactive view with Cn3D
second cyclin box found in cyclin-T2 (CCNT2)
CCNT2, also termed CycT2, is a regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin T) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to production elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNAP II). CCNT2 contains two cyclin boxs. The model responds to the second one. The cyclin box is a protein binding domain.
Statistics
?
PSSM-Id: 410301
Aligned: 7 rows
Threshold Bit Score: 227.271
Created: 8-Jul-2019
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative AF4
Conserved site includes 22 residues -Click on image for an interactive view with Cn3D
Feature 1:putative AF4 family member binding site [polypeptide binding site]
Evidence:
  • Comment:based on the structure of human cyclin-T1 in complex with AFF4 (4OR5) defined at 4A contacts
  • Comment:P-TEFb (CDK9/cyclin T) is also a component of the super elongation complex (SEC) comprised of an AF4 family member AFF1 or AFF4, AF9/ENL, ELL1/2/3, and EAF1/2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    ###   ## ##                            #   ######    ##   #  #      
2IVX_A       144 EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVT 223 human
XP_006011564 150 EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDQGVN 229 coelacanth
XP_015281271 164 EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPSVT 243 Gekko japonicus
NP_001087615 150 EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDQTVT 229 African clawed ...
O60583       150 EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVT 229 human
XP_007894384  84 EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVT 163 elephant shark
NP_997751    151 EHPHTDVVRCTQLVRASKDLAQTSYFMATNSLHLTTFCLQHKPTVVACVCIHLACKWSNWEIPVSSDGKHWWEYVDRAVT 230 zebrafish
Feature 1            #  ##  #                      
2IVX_A       224 LELLDELTHEFLQILEKTPNRLKKIRNWRANQAA 257 human
XP_006011564 230 LELLDELTHEFLQILEKTPSRLKKIRNWRANQAA 263 coelacanth
XP_015281271 244 LELLDELTHEFLQILEKTPSRLKRIRNWRANQAA 277 Gekko japonicus
NP_001087615 230 LELLDELTHEFLQILEKTPSRLKRIRNWRANQAA 263 African clawed frog
O60583       230 LELLDELTHEFLQILEKTPNRLKKIRNWRANQAA 263 human
XP_007894384 164 LELLDELTHEFLQILEKTPSRLKRIRNWRANQAA 197 elephant shark
NP_997751    231 LQLLDDLTHEFLQILEKTPSRLKRIRNWRATQAA 264 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap