Conserved Protein Domain Family
FH_FOXB1

?
cd20042: FH_FOXB1 
Forkhead (FH) domain found in Forkhead box protein B1 (FOXB1) and similar proteins
FOXB1, also called transcription factor FKH-5, is a winged helix transcription factor that controls development of mammary glands and regions of the central nervous system (CNS) that regulate the milk-ejection reflex. It is essential for access of mammillothalamic axons to the thalamus. The FH domain is a winged helix DNA-binding domain. FOX transcription factors recognize the core sequence 5'-(A/C)AA(C/T)A-3'.
Statistics
?
PSSM-Id: 410816
Aligned: 5 rows
Threshold Bit Score: 193.045
Created: 18-Dec-2018
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
putative DNA
Feature 1:putative DNA binding site [nucleic acid binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #                 ##  #                  ## ##  #      #         ### #
Q99853         8 TYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFW 87  human
XP_005987799   8 TYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFW 87  coelacanth
XP_007905716   8 TYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFW 87  elephant shark
NP_571360      8 TYSDQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFW 87  zebrafish
PKK25442       8 TYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFW 87  rock pigeon
Feature 1                    
Q99853        88 ALHPsCGDMFEN 99  human
XP_005987799  88 ALHPsCGDMFEN 99  coelacanth
XP_007905716  88 ALHPnCGDMFEN 99  elephant shark
NP_571360     88 ALHPsCGDMFEN 99  zebrafish
PKK25442      88 ALHPsCGDMFEN 99  rock pigeon

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap