Conserved Protein Domain Family
FH_FOXA1

?
cd20038: FH_FOXA1 
Forkhead (FH) domain found in Forkhead box protein A1 (FOXA1) and similar proteins
FOXA1, also called hepatocyte nuclear factor 3-alpha (HNF-3-alpha or HNF-3A) or transcription factor 3A (TCF-3A), acts as a transcription factor that is essential for epithelial lineage differentiation. It has been found to be upregulated in numerous cancers. The FH domain is a winged helix DNA-binding domain. FOX transcription factors recognize the core sequence 5'-(A/C)AA(C/T)A-3'.
Statistics
?
PSSM-Id: 410812
Aligned: 6 rows
Threshold Bit Score: 233.481
Created: 18-Dec-2018
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
 
DNA binding
Feature 1:DNA binding site [nucleic acid binding site]
Evidence:
  • Comment:Based on the structure evidences that Homo sapiens FOXA2 (5X07) and FOXA3 (1VTN) bind DNA through the Forkhead domain.
  • Citation:PMID 8332212

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         ##                 #                   #  ## ##  #      #      
P55317       157 GDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPD 236 human
Q8AWH1       145 RDTKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFLYYRQNQQRWQNSIRHSLSFNDCFVKVARSPD 224 tropical clawed...
XP_005989222 149 RDTKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFIKVARSPD 228 coelacanth
AAC06367     144 RDNKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPD 223 zebrafish
OPJ83188      83 RDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPD 162 Patagioenas fas...
XP_007891554 148 RDTKNFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFIKVARSPD 227 elephant shark
Feature 1            ## #               ### ##   
P55317       237 KPGKGSYWTLHPDSGNMFENGCYLRRQKRFKC 268 human
Q8AWH1       225 KPGKGSYWTLHPDSGNMFENGCYLRRQKRFKC 256 tropical clawed frog
XP_005989222 229 KPGKGSYWTLHPDSGNMFENGCYLRRQKRFKC 260 coelacanth
AAC06367     224 KPGKGSYWTLHPDSGNMFENGCYLRRQKRFKC 255 zebrafish
OPJ83188     163 KPGKGSYWTLHPDSGNMFENGCYLRRQKRFKS 194 Patagioenas fasciata monilis
XP_007891554 228 KPGKGSYWTLHPDSGNMFENGCYLRRQKRFKC 259 elephant shark

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap