1G4A,1DO2,1E94,1G3I,1IM2,1OFH,5JI2


Conserved Protein Domain Family
RecA-like_HslU

?
cd19498: RecA-like_HslU 
ATP-dependent protease ATPase subunit HslU
HslU is a component of the ATP-dependent protease HslVU. In HslVU, HslU ATPase serves to unfold and translocate protein substrate, and the HslV protease degrades the unfolded proteins. This RecA-like_HslU subfamily belongs to the RecA-like NTPase family which includes the NTP binding domain of F1 and V1 H(+)ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. The RecA-like NTPase family also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Statistics
?
PSSM-Id: 410906
Aligned: 21 rows
Threshold Bit Score: 280.805
Created: 27-Nov-2017
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
ATP bindinghexamer
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Structure:1G4A; Escherichia coli HslU with bound ADP, contacts at 4A
    View structure with Cn3D
  • Comment:contains Walker A and Walker B motifs

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                ###                                        #######                   
1G4A_E      5 TPREIVSELDKHIIGQDNAKRSVAIALRNRWRRmqlneelrhevtPKNILMIGPTGVGKTEIARRLAklanaPFIKVEAt 84  Escherichia coli
Q57VB1     53 KPRELMQELDNYIIGQTEAKKAVAVALRNRWRRhqvdaaireeisPKNILMIGPTGVGKTEIARRLAklvdaPFIKVEAt 132 Trypanosoma brucei...
B8FRG8      5 TPRETVRELDRYIVGQNQAKRAVAIALRNRYRRsllpegmqeevlPKNILMIGPTGVGKTEIARRLAklvraPFLKVEAt 84  Desulfitobacterium...
P39778      7 TPRQIVDRLDQYIVGQQNAKKAVAVALRNRYRRslldeklkdevvPKNILMMGPTGVGKTEIARRIAklsgaPFIKIEAt 86  Bacillus subtilis ...
Q98CU1      5 SPREIVSELDRFIIGQKDAKRAVAIALRNRWRRqqlegqmreevmPKNILMIGPTGVGKTEISRRLArlagaPFVKVEAt 84  Mesorhizobium loti...
1DO2_A      4 TPREIVSELDKHIIGQDNAKRSVAIALRNRWRRmqlneelrhevtPKNILMIGPTGVGKTEIARRLAklanaPFIKVEAt 83  Escherichia coli
1E94_E     11 TPREIVSELDKHIIGQDNAKRSVAIALRNRWRRmqlneelrhevtPKNILMIGPTGVGKTEIARRLAklanaPFIKVEAt 90  Escherichia coli
1G3I_A      5 TPREIVSELDQHIIGQADAKRAVAIALRNRWRRmqlqeplrhevtPKNILMIGPTGVGKTEIARRLAklanaPFIKVEAt 84  Haemophilus influe...
1IM2_A      5 TPREIVSELDQHIIGQADAKRAVAIALRNRWRRxqlqeplrhevtPKNILXIGPTGVGKTEIARRLAklanaPFIKVEAt 84  Haemophilus influe...
1OFH_A      5 TPREIVSELDQHIIGQADAKRAVAIALRNRWRRmqlqeplrhevtPKNILMIGPTGVGKTEIARRLAklanaPFIKVEAt 84  Haemophilus influe...
Feature 1                                                                                     
1G4A_E     85 kftevGYVGKEVDSIIRDLTDaavkmvrvqaieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklr 164 Escherichia coli
Q57VB1    133 kftevGFHGRDVESIIEDLYKasltqtkqnimrrheetarqkaenrilkalagvsdgfrehlrsgalddievivelqekk 212 Trypanosoma brucei...
B8FRG8     85 kftevGYVGRDVESIVRDLVEislrmvkaekmeeveiqaaqaaekrleallvpgkrqennssnpfqflfnqgqekeetvt 164 Desulfitobacterium...
P39778     87 kftevGYVGRDVESMVRDLVEtsvrlikeekmnevkeqaeenankrivrllvpgkkkqsgvknpfemffggsqpngedea 166 Bacillus subtilis ...
Q98CU1     85 kftevGYVGRDVEQIIRDLVEiaiglvrekmredvkarahinaeervlealvgktaspatrdsfrkklrdgelddkeiei 164 Mesorhizobium loti...
1DO2_A     84 kftevGYVGKEVDSIIRDLTDaavkmvrvqaieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklr 163 Escherichia coli
1E94_E     91 kftevGYVGKEVDSIIRDLTDaavkmvrvqaieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklr 170 Escherichia coli
1G3I_A     85 kftevGYVGKEVDSIIRDLTDsamklvrqqeiaknraraedvaeerildallppaknqwgevenhdshsstrqafrkklr 164 Haemophilus influe...
1IM2_A     85 kftevGYVGKEVDSIIRDLTDsaxklvrqqeiaknraraedvaeerildallppaknqwgevenhdshsstrqafrkklr 164 Haemophilus influe...
1OFH_A     85 kftevGYVGKEVDSIIRDLTDsaggai----------------------------------------------------- 111 Haemophilus influe...
Feature 1                                                                                     
1G4A_E    165 egqlddkeieidla---------------------aapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamk 223 Escherichia coli
Q57VB1    213 ekpkn---------------------------------------sgtnegvfisleipssiggqrpqtvkkvmkikdaip 253 Trypanosoma brucei...
B8FRG8    165 peierdrtfirerlhrgelde-------qvievevednqpllpdflgtgmeintnlqdmmagmlpkkrhkrkvtvrearr 237 Desulfitobacterium...
P39778    167 esqeeanieekrkrmahqlalgeledyyvtveveeqqpsmfdmlqgsgmeqmgmnmqdalsglmpkkkkrrkmtvreark 246 Bacillus subtilis ...
Q98CU1    165 evadtgnggmp---------------------------gfeipgmpganigvlnindmlskamggkktksrkttvkesyd 217 Mesorhizobium loti...
1DO2_A    164 egqlddkeieidla---------------------aapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamk 222 Escherichia coli
1E94_E    171 egqlddkeieidla---------------------aapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamk 229 Escherichia coli
1G3I_A    165 egqlddkeieidvs--------------------agvsmgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalk 224 Haemophilus influe...
1IM2_A    165 egqlddkeieidvs--------------------agvsxgveixappgxeextnqlqslfqnlgsdktkkrkxkikdalk 224 Haemophilus influe...
1OFH_A        --------------------------------------------------------------------------------     Haemophilus influe...
Feature 1                                                                                     
1G4A_E    224 llieeeaaklvnpeelkqdaidaveqhGIVFIDEIDkickrges-sgpdvsreGVQRDLLPLVEGCTVSTKH-GMVKTDH 301 Escherichia coli
Q57VB1    254 avlqeeldkivdtedvsaealraceedGIVVIDEIDkivtasggykghqasaeGVQQDLLPLVEGTTVSTKGnVQIKTDK 333 Trypanosoma brucei...
B8FRG8    238 iltteeaqklidhdeavqeairrveqeGMVFLDEIDkiagrdga-sgpdvsrgGVQRDILPIVEGSTINTKY-GPVKTDH 315 Desulfitobacterium...
P39778    247 vltneeasklidmdevgqeavqraeesGIIFIDEIDkiaknggasssadvsreGVQRDILPIVEGSTVVTKY-GSVKTDH 325 Bacillus subtilis ...
Q98CU1    218 llvsdesdklldqdevvrraldatendGIVFLDEIDkiaarsdi--sggpsreGVQRDLLPLVEGTTVATKY-GPVKTDH 294 Mesorhizobium loti...
1DO2_A    223 llieeeaaklvnpeelkqdaidaveqhGIVFIDEIDkickrges-sgpdvsreGVQRDLLPLVEGCTVSTKH-GMVKTDH 300 Escherichia coli
1E94_E    230 llieeeaaklvnpeelkqdaidaveqhGIVFIDEIDkickrges-sgpdvsreGVQRDLLPLVEGCTVSTKH-GMVKTDH 307 Escherichia coli
1G3I_A    225 aliddeaaklinpeelkqkaidaveqnGIVFIDEIDkickkgey-sgadvsreGVQRDLLPLVEGSTVSTKH-GMVKTDH 302 Haemophilus influe...
1IM2_A    225 aliddeaaklinpeelkqkaidaveqnGIVFIDEIDkickkgey-sgadvsreGVQRDLLPLVEGSTVSTKH-GXVKTDH 302 Haemophilus influe...
1OFH_A    112 ---------------------daveqnGIVFIDEIDkickkgey-sgadvsreGVQRDLLPLVEGSTVSTKH-GMVKTDH 168 Haemophilus influe...
Feature 1                                    
1G4A_E    302 ILFIASGAfqiakpsdLIPELQGRLPIRVEL 332 Escherichia coli
Q57VB1    334 ILFICSGAfhsvkpsdMLAELQGRLPIRVEL 364 Trypanosoma brucei brucei TREU927
B8FRG8    316 ILFIAAGAfhvakpsdLIPELQGRFPIRVEL 346 Desulfitobacterium hafniense DCB-2
P39778    326 VLFIAAGAfhmakpsdLIPELQGRFPIRVEL 356 Bacillus subtilis subsp. subtilis str. 168
Q98CU1    295 ILFIASGAfhvskpsdLLPELQGRLPIRVEL 325 Mesorhizobium loti MAFF303099
1DO2_A    301 ILFIASGAfqiakpsdLIPELQGRLPIRVEL 331 Escherichia coli
1E94_E    308 ILFIASGAfqiakpsdLIPELQGRLPIRVEL 338 Escherichia coli
1G3I_A    303 ILFIASGAfqvarpsdLIPELQGRLPIRVEL 333 Haemophilus influenzae
1IM2_A    303 ILFIASGAfqvarpsdLIPELQGRLPIRVEL 333 Haemophilus influenzae
1OFH_A    169 ILFIASGAfqvarpsdLIPELQGRLPIRVEL 199 Haemophilus influenzae Rd KW20

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap