4EIW,1G4A,4I34,5D4W,3M6A,4XGU,4L15,4WW0,3H4M,3J94,5VC7,5G4G,5VC7,5KZF,5KWA


Conserved Protein Domain Family
RecA-like_protease

?
cd19481: RecA-like_protease 
proteases similar to RecA
RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H(+)ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Statistics
?
PSSM-Id: 410889
Aligned: 46 rows
Threshold Bit Score: 73.8563
Created: 21-Apr-2017
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
ATP binding
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Structure:4EIW; Thermus thermophilus FtsH with bound ADP, contacts at 4A
    View structure with Cn3D
  • Comment:contains Walker A and Walker B motifs

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                 ########                                
4EIW_A         48 AKEELKEIVeflknpsrf-------hemgaripKGVLLVGPPGVGKTHLARAVAgea--------rvPFITASGsdfvem 112  Thermus therm...
1G4A_E         23 AKRSVAIALrnrwrrmqln-----eelrhevtpKNILMIGPTGVGKTEIARRLAkla--------naPFIKVEAtkftev 89   Escherichia coli
4I34_A         23 AKKVLAVAVynhykrlrng----dtsngvelgkSNILLIGPTGSGKTLLAETLArll--------dvPFTMADAttltea 90   Escherichia c...
3M6A_A         89 VKERILEYLavqklt-------------kslkgPILCLAGPPGVGKTSLAKSIAksl--------grKFVRISLggvrde 147  Bacillus subt...
A2T308       1637 TPASLQLGSfp---------------------sKGILLIGPMETGRSYLIKNLAadsylpsiripvnKLLYNKLdfkntp 1695 Angiopteris e...
Q7ZV60        201 IVDDVKEFIgnpkwyt----------drgipyrRGYLLYGPPGCGKSSFITALAgelg------ysiCLMSLSDrsls-- 262  zebrafish
Q0P3N5        733 VTLKLLQLIenelshspvisalkpgryglntlpKGMLLVGDPGNGRSFLARAIAses--------rlPVFKTEStrfldv 804  Ostreococcus ...
NP_866938     242 TLTLLERNVvefarnrqr------lselgmskkKGVLFYGPPGTGKTHTIHHLAgsl-------eghTTILISAeqv--- 305  Rhodopirellul...
O34703        193 LKKEIYRSIdqffhsdksf-----yqtydipykRGILLYGPPGNGKTTLVKSIAgsi--------daPVAYWQIteft-- 257  Bacillus subt...
YP_003770803  218 LPDGVLDAIerhtigiarhg--erllaagqhlkRGLLLHGPPGTGKTHTVRYLMgr---------lpDTTVIILtgta-- 284  Amycolatopsis...
Feature 1                                                                                         
4EIW_A        113 f------vgvgaarVRDLFETAKRha------------------------------------------------------ 132  Thermus therm...
1G4A_E         90 --------gyvgkeVDSIIRDLTDaavkmvrvqaieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrk 161  Escherichia coli
4I34_A         91 --------gyvgedVENIIQKLLQkcdydv-------------------------------------------------- 112  Escherichia c...
3M6A_A        148 seirghrrtyvgamPGRIIQGMKKagk----------------------------------------------------- 174  Bacillus subt...
A2T308       1696 ati---lskqsllrLNLLFESAEKms------------------------------------------------------ 1718 Angiopteris e...
Q7ZV60        263 -----------ddrLNHLLSVAPQq------------------------------------------------------- 276  zebrafish
Q0P3N5        805 --------kfgvmrLMSLFRRVRDqa------------------------------------------------------ 822  Ostreococcus ...
NP_866938     306 ------------glLGEYMTLARLlq------------------------------------------------------ 319  Rhodopirellul...
O34703        258 ----------ssetIEEVFQAARRla------------------------------------------------------ 273  Bacillus subt...
YP_003770803  285 -----------mklVGKAAELARRlq------------------------------------------------------ 299  Amycolatopsis...
Feature 1                                                                                         
4EIW_A            --------------------------------------------------------------------------------      Thermus therm...
1G4A_E        162 klregqlddkeieidlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq 241  Escherichia coli
4I34_A            --------------------------------------------------------------------------------      Escherichia c...
3M6A_A            --------------------------------------------------------------------------------      Bacillus subt...
A2T308            --------------------------------------------------------------------------------      Angiopteris e...
Q7ZV60            --------------------------------------------------------------------------------      zebrafish
Q0P3N5            --------------------------------------------------------------------------------      Ostreococcus ...
NP_866938         --------------------------------------------------------------------------------      Rhodopirellul...
O34703            --------------------------------------------------------------------------------      Bacillus subt...
YP_003770803      --------------------------------------------------------------------------------      Amycolatopsis...
Feature 1                                                                                         
4EIW_A        133 --------pCIVFIDEIDavgrkrgsgvg----ggndereqtlNQLLVEMdgfek-------------------dtaiVV 181  Thermus therm...
1G4A_E        242 daidaveqhGIVFIDEIDkickrgess-------gpdvsregvQRDLLPLvegctvstk----------hgmvktdhiLF 304  Escherichia coli
4I34_A        113 ----qkaqrGIVYIDEIDkisrksdnpsi----trdvsgegvqQALLKLIegtvaavppqggrkhpqqeflqvdtskiLF 184  Escherichia c...
3M6A_A        175 -------lnPVFLLDEIDkmssdf--------------rgdpsSAMLEVLdpeqnssfsdh------yieetfdlskvLF 227  Bacillus subt...
A2T308       1719 --------pCIIWIQDIHelninrf-----------ghrseadPKLLLCSvlknisnss-----------fnsytknnIV 1768 Angiopteris e...
Q7ZV60        277 ---------SIILLEDVDaafvsrellptenplayqgmgrltfSGLLNALdgvas-------------------searIV 328  zebrafish
Q0P3N5        823 --------pGILFIRDIDlitidrert-------nspeliqltTQFLICFdgyyigse------------arptqrkiFT 875  Ostreococcus ...
NP_866938     320 --------pSMVVMEDVDliarertsm-------esaceevllNKLLNEMdglke-------------------daeiFF 365  Rhodopirellul...
O34703        274 --------pAVLVIEDIDsmpe------------------dvrSFFLNTLdgats-------------------keglFL 308  Bacillus subt...
YP_003770803  300 --------pSVVVLEDVDliaqdrsy---------gpmvqpllFTLLDAMdgvgg-------------------dadvTF 343  Amycolatopsis...
Feature 1                                                                                 
4EIW_A        182 MAATNrp---------------------------------------------diLDPALLRp-gRFDRQIAI 207  Thermus thermophilus HB8
1G4A_E        305 IASGAfqia-----------------------------------------kpsdLIPELQG---RLPIRVEL 332  Escherichia coli
4I34_A        185 ICGGAfagldkvishrvetgsgigfgatvkaksdkasegellaqvepedlikfgLIPEFIG---RLPVVATL 253  Escherichia coli K-12
3M6A_A        228 IATANnl----------------------------------------------aTIPGPLR---DRMEIINI 250  Bacillus subtilis sub...
A2T308       1769 IASTHmp---------------------------------------------tkVDPAIISp-nRLDQLINL 1794 Angiopteris evecta
Q7ZV60        329 FMTTNfi---------------------------------------------erLDPALVRp-gRVDLKQYV 354  zebrafish
Q0P3N5        876 LGSVSdi---------------------------------------------trMDPACLRs-gRFEWVVNL 901  Ostreococcus tauri
NP_866938     366 VLTTNrp---------------------------------------------eaLEAALASrpgRVDQAIEF 392  Rhodopirellula baltic...
O34703        309 IGTTNyp---------------------------------------------eeIDPGLMNragRFDRAYEI 335  Bacillus subtilis sub...
YP_003770803  344 LLTTNra---------------------------------------------seLEKALADrpgRVDLAVEI 370  Amycolatopsis mediter...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap