Conserved Protein Domain Family
RING-HC_TRIM41-like_C-IV

?
cd16602: RING-HC_TRIM41-like_C-IV 
RING finger, HC subclass, found in tripartite motif-containing proteins TRIM41, TRIM52 and similar proteins
TRIM41 and TRIM52, two closely related tripartite motif-containing proteins, have dramatically expanded RING domains compared with the rest of the TRIM family proteins. TRIM41 belongs to the C-IV subclass of the TRIM (tripartite motif) family of proteins that are defined by their N-terminal RBCC (RING, Bbox, and coiled coil) domains, including three consecutive zinc-binding domains, a C3HC4-type RING-HC finger, Bbox1 and Bbox2, and a coiled coil region, as well as a B30.2/SPRY (SplA and ryanodine receptor) domain positioned C-terminal to the RBCC domain. In contrast, TRIM52 lacks the putative viral recognition SPRY/B30.2 domain, and thus has been classified to the C-V subclass of the TRIM family that contains only RBCC domains. TRIM41, also known as RING finger-interacting protein with C kinase (RINCK), is an E3 ubiquitin-protein ligase that promotes the ubiquitination of protein kinase C (PKC) isozymes in cells. It specifically recognizes the C1 domain of PKC isozymes. It controls the amplitude of PKC signaling by controlling the amount of PKC in the cell. TRIM52, also known as RING finger protein 102 (RNF102), is encoded by a novel, noncanonical antiviral TRIM52 gene in primate genomes with unique specificity determined by the rapidly evolving RING domain.
Statistics
?
PSSM-Id: 438264
Aligned: 6 rows
Threshold Bit Score: 85.7482
Created: 15-Apr-2016
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
 
Zn binding site
Feature 1: Zn binding site [ion binding site], 8 residue positions
Conserved feature residue pattern:C C C H C C C CClick to see conserved feature residue pattern help
Evidence:
  • Comment:based on the structures of other RING-HC fingers with bound zinc
  • Comment:C3HC4-type RING-HC finger consensus motif: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C, where X is any amino acid and the number of X residues varies in different fingers
  • Comment:A RING finger typically binds two zinc atoms, with its Cys and/or His side chains in a unique "cross-brace" arrangement.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #           # #  #  #                                                   
Q8WV44        15 QEEAVCAICLDYFtDPVSIGCGHNFCRVCVTQLWGgedeedrdeldreeeeedgeeeeveavgagagwdtpmrdedyegd 94  human
NP_001025843  21 QEEAICAICLDYFvEPVSIGCGHNFCRVCIAQLWGggeaeveesggaaaleeeeeeleeeeedelgeeeldelwdgvvqg 100 chicken
Q96A61        15 QEEAVCAICLDYFkDPVSISCGHNFCRGCVTQLWSkedeedqneeedeweeeedeeavgamdgwdgsirevlyrgnadee 94  human
EMP25895      11 QEETNCPICLEYLrDPVTVQCGHNFCQVCITQLWGgeeegegqaeyeaagddvgmggeeddvdelddddnveyneeeegd 90  green sea turtle
Q5NCC3        15 QEEAVCAICLDYFtDPVSIGCGHNFCRVCVTQLWGgedeedrdeldreeeeeevgeeeeveavgagggwdtpmreedyeg 94  house mouse
ELR59726      15 QEEAVCAICLDYFkDPVSIGCGHNFCRGCVTQLWGtpp------------------------------------------ 52  wild yak
Feature 1                                                                                        
Q8WV44        95 meeeveeeeegvfwtsgmsrsswdnmdyvweeedeeedldyylgdmeeedlrgedeedeeevleeveeedldpvtplppp 174 human
NP_001025843 101 -----------------------------------------elyfgdddydedvmeedveeeeeeedeaqsppppvlpar 139 chicken
Q96A61        95 lfqdqdddelwlgdsgitnwdnvdymwdeeeeeeeedqdyylgglrpdlridvyreeeileaydededeelypdihppps 174 human
EMP25895      91 gdngaeeeddmwseeded-----tdlwddpgeddmwedevgdelffeeddydeevmeeedleeeeeeplpppppaavvtr 165 green sea turtle
Q5NCC3        95 dmeeeaeeeeevfwssgiggsnwdnmdyvweeeeeeeeeeldyylgdvadlrgededeeeevleedeeeeldpitqlppp 174 house mouse
ELR59726         --------------------------------------------------------------------------------     wild yak
Feature 1                #  #            
Q8WV44       175 paprrcFTCPQCRKSFPRRSFRPN 198 human
NP_001025843 140 prrlqtFTCPQCRKTFFQRNFRPN 163 chicken
Q96A61       175 lplpgqFTCPQCRKSFTRRSFRPN 198 human
EMP25895     166 prhpttFTCPQCRKTFPQRNFRPN 189 green sea turtle
Q5NCC3       175 paprrcFTCPQCRKSFPRRSFRPN 198 house mouse
ELR59726      53 ----rqFTCPQCRKSFKRRSFRPN 72  wild yak

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap