Conserved Protein Domain Family
RING-H2_Pep3p-like

?
cd16462: RING-H2_Pep3p-like 
RING finger, H2 subclass, found in Saccharomyces cerevisiae vacuolar membrane protein PEP3 (Pep3p) and similar proteins
Pep3p, also known as carboxypeptidase Y-deficient protein 3, vacuolar morphogenesis protein 8, vacuolar protein sorting-associated protein 18 (Vps18p), or vacuolar protein-targeting protein 18, is a vacuolar membrane protein that affects late Golgi functions required for vacuolar protein sorting and efficient alpha-factor prohormone maturation. It is required for vacuolar biogenesis and for trafficking of hydrolase precursors to the vacuole. The disruption of PEP3 may cause hypersensitivity to heat shock and ethanol stresses, probably due to disappearance of normal vacuoles. As a component of the homotypic fusion and vacuole protein sorting (HOPS) and class C core vacuole/endosome tethering (CORVET) complexes, its overexpression shortens lag phase but does not alter growth rate in Saccharomyces cerevisiae exposed to acetic acid stress. Moreover, Pep3p forms the Class C Vps protein complex (C-Vps complex) with Pep5p (also known as Vps11), Vps16, and Vps33, and is necessary for trafficking of hydrolase precursors to the vacuole by promoting vesicular docking reactions with SNARE proteins. Pep3p contains a C3H2C3-type RING-H2 finger at the C-terminus.
Statistics
?
PSSM-Id: 438125
Aligned: 27 rows
Threshold Bit Score: 61.928
Created: 7-Aug-2015
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
 
Zn binding site
Feature 1: Zn binding site [ion binding site], 8 residue positions
Conserved feature residue pattern:C C C H H C C CClick to see conserved feature residue pattern help
Evidence:
  • Comment:based on the structures of other RING-H2 fingers with bound zinc
  • Comment:C3H2C3-type RING-H2 finger consensus motif: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-H-X2-C-X(4-48)-C-X2-C, where X is any amino acid and the number of X residues varies in different fingers
  • Comment:A RING finger typically binds two zinc atoms, with its Cys and/or His side chains in a unique "cross-brace" arrangement.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #  #                     # #  #  #                                            
P27801        824 KSCDECGKFLQi--------kKFIVFPCGHCFHWNCIIRVIlnsndynlrqkte-------------------------- 869  baker's yeast
EAS04688      982 KTCRECNRPLYt--------dSFYIFPCKHGFHQACLIYKVikndddqiklekintlnskieqiqksieslttrkrasse 1053 Tetrahymena t...
XP_001581471 2651 ELCEFCRQSLYt--------dKFIVFPCHHALHIHCFLENMdlffepveqlnlia------------------------- 2697 Trichomonas v...
XP_001322688  765 ESCACCGKLLFt--------gQGVVFPCKHGFHTECIKQMFqkl------------------------------------ 800  Trichomonas v...
XP_027483126  849 HRCMQCATALLq--------rQFYLFPCRHGFHADCLTQLVtqhlssrrlrrllqlqnelaaadgtseprptsptkskvs 920 
XP_001018740  906 VTCMECVQSLFn--------eSFYIFPCMHGFHKACLIQRMkkdnidqgkinqieqlnqeieilqqkqlkievrkrqsgs 977 
XP_024542677  844 EECADCRRKILaydplhgpasLFYVFPCEHCFHTECLINYMlktgekaerdrilelkkrmsvlavek------------- 910  Selaginella m...
XP_001612191  858 AECISCGTPLHt--------sQFIVFPCSHAFHRACIAATLrkllkgyelselqrl------------------------ 905 
OHT14808      736 HGCSRCGRPLLn--------eQGIVYPCSHALHRHCAEEACvgln----------------------------------- 772 
CDW90404      944 QMCDICFTSIFk--------kEFYVFPCLHAFHRECVYKYIknyetkdpkvrvniekikslfaeienikqkavfiqsaas 1015
Feature 1                                                                                         
P27801        870 -----------------------------------------------------------------------nflkakskh 878  baker's yeast
EAS04688     1054 didi-------------------------------------glfnnplnklvnfvashaieedneentvqleqyqkellk 1096 Tetrahymena t...
XP_001581471 2698 ----------------------------------------------------------------------lqanalkred 2707 Trichomonas v...
XP_001322688      --------------------------------------------------------------------------------      Trichomonas v...
XP_027483126  921 sssfplstslerlrehvrpqaivdaitaglsvgvtsgrralapldpsmsirpaskgksstqaesanasvtsaswtaqldk 1000
XP_001018740  978 g-------------------------------------------ffnninqifsaarggseeieinqqqmslneerelqe 1014
XP_024542677  911 ----------------------------------------------------------pphskkdylaeeeesgihpldq 932  Selaginella m...
XP_001612191  906 ---------------------------------------------------------------------hnafekrsdeh 916 
OHT14808          --------------------------------------------------------------------------------     
CDW90404     1016 ggsmfggnfglggaagg------------mfggpddemkkslisdirnyftksvrggmvtgistqntqmlqqkdqedirr 1083
Feature 1                     #  #     
P27801        879 nlndLENIIVEKCGLCSDINI 899  baker's yeast
EAS04688     1097 yreeLDQLLAIECIECGPSIV 1117 Tetrahymena thermophila SB210
XP_001581471 2708 trakLIDALSKSCPFCGELSV 2728 Trichomonas vaginalis G3
XP_001322688  801 --niKDVPITKNCPLCSFLST 819  Trichomonas vaginalis G3
XP_027483126 1001 lraeLNTIVAGTCPICTLSVR 1021
XP_001018740 1015 qkqkIDQLLANECIFCGPGVV 1035
XP_024542677  933 anaeIAEIVANECPHCGERSV 953  Selaginella moellendorffii
XP_001612191  917 svkkYNEFLSKSCVICSYPSS 937 
OHT14808      773 tkpgEYIDVTLDCPICGFLCM 793 
CDW90404     1084 ifnkIDEILTRECFYCGSILI 1104

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap