Conserved Protein Domain Family
CUE2_Cue2p_like

?
cd14375: CUE2_Cue2p_like 
CUE2 domain found in yeast ubiquitin-binding protein CUE2 (Cue2p) and similar proteins
Cue2p, also called coupling of ubiquitin conjugation to ER degradation protein 2, is encoded by the open reading frame (ORF) YKL090W. It is involved in the intramolecular monoubiquitination that serves as a regulatory signal in a variety of cellular processes in yeast. Cue2p contains two tandem CUE domains at the N-terminus. Both of them can bind monoubiquitin independently. This model corresponds to the second CUE domain.
Statistics
?
PSSM-Id: 270558
Aligned: 6 rows
Threshold Bit Score: 59.3538
Created: 3-Apr-2013
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P36075        57 DNELHQLYDMFPQLDCSVIKDQFVINeKSVESTISDLL 94  Saccharomyces cerevisiae S288c
CCE89602      56 SDPLDELKAMFPNVDSKTIEDVYQRS-KSIEAATSELL 92  Torulaspora delbrueckii
XP_001447571  25 QLPPQTLYDMFPSFDKELIEQCYRSEkANIENTVSKLL 62  Paramecium tetraurelia strain d4-2
CCA70452      34 SEDERHLQSIFPDLDETTIHDCYVLCeRNVERTVEFLL 71  Piriformospora indica DSM 11827
EGF78844      20 LGIMEDLKRMFANVDAEVIEEVFLAQnNDMERTVNALL 57  Batrachochytrium dendrobatidis JAM81
XP_002765014  95 KNDLDELKDMFSNFDSELIQDLYLGLnLDKQATVEALL 132 Perkinsus marinus ATCC 50983
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap