1ZPU


Conserved Protein Domain Family
CuRO_3_Fet3p

?
cd13899: CuRO_3_Fet3p 
Click on image for an interactive view with Cn3D
The third Cupredoxin domain of multicopper oxidase Fet3p
Fet3p catalyzes the ferroxidase reaction, which couples the oxidation of Fe(II) to Fe(III) with the four-electron reduction of molecular oxygen to water. Fet3p is a type I membrane protein with the amino-terminal oxidase domain in the extracellular space and the carboxyl terminus in the cytoplasm. The periplasmic produced Fe(III) is transferred to the permease Ftr1p for import into the cytosol. The four copper ions are inserted post-translationally and are essential for catalytic activity, thus linking copper and iron homeostasis. Like other related multicopper oxidases (MCOs), Fet3p is composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 3 of 3-domain MCOs contains the Type 1 (T1) copper binding site and part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
Statistics
?
PSSM-Id: 259966
Aligned: 24 rows
Threshold Bit Score: 224.825
Created: 24-Oct-2012
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1: Type 1 (T1) Cu binding site [ion binding site], 4 residue positions
Conserved feature residue pattern:H C H XClick to see conserved feature residue pattern help
Evidence:
  • Structure:1ZPU; Saccharomyces cerevisiae Multicopper Oxidase Fte3P binds to copper at T1 copper center.
  • Comment:Type 1 (T1) copper sites are characterized by their conserved H...C...H...M copper ligands.
  • Comment:Some members bind copper at the T1 site with three amino acid residues (HCH), instead of four (HCHM).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                         
1ZPU_A        315 DHVITVDVVMDNlk---nGVNYAFFNNi-------tYTAPKVPTLMtvlssgdqa--nnseiygsNTHTFILEKDEIVEI 382  baker's yeast
P43561        339 HYDHQIVMDVRMvnl-gdGVKYAFFNNi-------tYVTPKVPTLTtlltsgkla--sdpriygdNINAQLLKHNDIIEV 408  baker's yeast
XP_002175763  331 DSSNLLQLDFDFytl-adGANYAAINGt-------pFVDPKVPGIMianstnfdgynlkpitygpYTNAIVLEHLQVIDI 402  Schizosacchar...
Q09920        336 ESNHSINIWFDFftl-gdGANYAEINDs-------sYVFPKVPSIMianstnvdgynlepvtygpYTNAYIFEYGDVVDV 407  fission yeast
CAD70788      336 AYDHLVKLDFRFcld-anGYPRACLNGk-------pFISQKVPSLYtaatvggn---ntnplvygQINPVVVRKGDIVQL 404  Neurospora cr...
ACJ13060      337 LEKVDRQIIFDTgvtqrdGRSVYTINGq-------tYVDPEEPTLYtalaaspen--asnasiygQVNPFVVQYGEVVEI 407  Aspergillus f...
EKD19016     1426 TMPIQLTVSFGTnq---nGQWRGYLNGi-------dYVPQKVPTLFtamnaplss-vndpsiygaSSNPFVLPMGAVVEV 1494 Marssonina br...
CCH43376      319 NPKHSIVLTYSSitlpnrDDDYFYTINsk------pFFPPQVPTLMtimsssphd-vlknqiygnLTNSYIFQKGDVVEV 391  Wickerhamomyc...
EKG17451      321 DHTITMEVNNLNi----dGVGFRITQGpd------pYISPRTPTLYtalstgfn---atdpeiygQVNPYVVNAGEVVRL 387  Macrophomina ...
BAI50015      336 LGPVNNRIDFTT------NQTYFEGIGtrtplnadpWVAPKVPTLYtalttgsm----dpatygpGVNPWIIQSGEIVQI 405  Cochliobolus ...
Feature 1                         #                                                               
1ZPU_A        383 VLNNqd-------tgTHPFHLHGHAFQTIQRdrtyddalgevp--------hsfdpdnhpafpEYPMRRDTLYVRpqSNF 447  baker's yeast
P43561        409 VLNNyd-------sgRHPFHLHGHNFQIVQKspgfhvdeaydeseqdemtvpynesaplqpfpERPMVRDTVVLEpsGHV 481  baker's yeast
XP_002175763  403 IVNNyd-------tgIHPFHMHGHVFEVLERgeedagvyd---------------fsvqhnysTNPVRRDTVDIWptSYV 460  Schizosacchar...
Q09920        408 IIDNhd-------tgKHPFHLHGHTFQVLERgeenaglys---------------dqeshtyyDNPMRRDTVEIEpgSFI 465  fission yeast
CAD70788      405 VINNqe-------aaGHPFHLHGHSFQILDRarpyagdw----------------pgrdvnynPVPNRRDTVTVWswSHA 461  Neurospora cr...
ACJ13060      408 IINNhh-------gnLHPWHMHGHQFQVLQRtipeggyf----------------dgyfanisSTPVKRDTIMVQnhGHA 464  Aspergillus f...
EKD19016     1495 TVQNhd-------gyAHPFHLHGHNFQVISRtpggsnf-------------------pinipaGAPMRRDTVQVMsdGSA 1548 Marssonina br...
CCH43376      392 IVKSed-------hmRHPFHLHGHNFQVLTRgshqhydk-----------------skdykfsETPMIRDTVNVPgsGFV 447  Wickerhamomyc...
EKG17451      388 VVNSndlvtannsgrGHPMHLHGHVFQVVGQfsehwdg-------------------ntssfpATPMKRDTTVLFagGSL 448  Macrophomina ...
BAI50015      406 HMNNph-------grPHPMHLHGHVFQVVAKgagtwdg-------------------qeggfpEVPSKRDGLVVPanGHA 459  Cochliobolus ...
Feature 1                        #    #    #        
1ZPU_A        448 VIRFKADNPGVWFFHCHIEWHLLQGLGLVLVEDP 481  baker's yeast
P43561        482 VLRFRADNPGVWYFHCHVDWHLQQGLASVFIEAP 515  baker's yeast
XP_002175763  461 VIRMIANNPGVWVFHCHIEWHMDSGLVATLVEAP 494  Schizosaccharomyces japonicus yFS275
Q09920        466 VIRFIADNPGAWVIHCHIEWHMESGLLATFIEAP 499  fission yeast
CAD70788      462 VLRFRADNPGVWLFHCHIEWHVEMGLTASFIEGP 495  Neurospora crassa
ACJ13060      465 VLRFRANNPGVWLIHCHIEWHVTKGLTGTLIEAP 498  Aspergillus fumigatus
EKD19016     1549 TIRFVADNPGITLFHCHVEWHVEAGLTATFIEAP 1582 Marssonina brunnea f. sp. 'multigermtubi' MB_m1
CCH43376      448 ILRFIADNPGVWFFHCHTDWHAARGLASLFIVAP 481  Wickerhamomyces ciferrii
EKG17451      449 VLQFRADNPGVWLFHCHIEWHLDAGMSATIIEAP 482  Macrophomina phaseolina MS6
BAI50015      460 VIRFKADNPGVWFFHCHVDFHAVGGMAATIIESP 493  Cochliobolus heterostrophus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap