3R27,2MQL


Conserved Protein Domain Family
RRM1_hnRNPL

?
cd12780: RRM1_hnRNPL 
Click on image for an interactive view with Cn3D
RNA recognition motif 1 (RRM1) found in vertebrate heterogeneous nuclear ribonucleoprotein L (hnRNP-L)
This subgroup corresponds to the RRM1 of hnRNP-L, a higher eukaryotic specific subunit of human KMT3a (also known as HYPB or hSet2) complex required for histone H3 Lys-36 trimethylation activity. It plays both, nuclear and cytoplasmic, roles in mRNA export of intronless genes, IRES-mediated translation, mRNA stability, and splicing. hnRNP-L shows significant sequence homology to polypyrimidine tract-binding protein (PTB or hnRNP I). Both, hnRNP-L and PTB, are localized in the nucleus but excluded from the nucleolus. hnRNP-L is an RNA-binding protein with three RNA recognition motifs (RRMs), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain).
Statistics
?
PSSM-Id: 410172
Aligned: 7 rows
Threshold Bit Score: 159.254
Created: 14-Sep-2011
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative RNA
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:putative RNA binding site [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to Homo sapiens polypyrimidine tract binding protein.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             # ##                       # #  ### #                              #####   
3R27_A        20 ASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI 99  human
AAD34009      49 ASPVVHVRGLIDGVVEPDLAEALQEFGTISYVVVMPKKRQALVEFEDINGACNAVNYAADNQIYVAGHPAFVNYSTSQKI 128 African clawed ...
2MQL_A        12 ASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKI 91  Norway rat
KGL97231       5 ASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDILGACNAVNYAADNQIYIAGHPAFVNYSTSQKI 84  killdeer
NP_998548     40 PSLVVHVRGLVDGVLESDIVEALQEFGTISYVVLMPKKRQALVEYEDMNGSCNAVTYANDNQIYIAGHPAFVNYSTSQKI 119 zebrafish
XP_014349233  52 PSQVVHIRGLIDGVMEADLYDGFEEFGAISYVVVMPKKRQALVEFEDIHGACNAVNYAADNQIYVAGHPSFVNYSTSQKI 131 coelacanth
XP_007883121  25 PSPVVHVRGLLDGVMEVDLMDSLQDFGTISYVMLIPNKRQALVEFEEIDGACGCVNYAADNPVYVAGQPAYLTFSTSQKI 104 elephant shark

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap