1FXL


Conserved Protein Domain Family
RRM1_HuD

?
cd12770: RRM1_HuD 
Click on image for an interactive view with Cn3D
RNA recognition motif 1 (RRM1) found in vertebrate Hu-antigen D (HuD)
This subgroup corresponds to the RRM1 of HuD, also termed ELAV-like protein 4 (ELAV-4), or paraneoplastic encephalomyelitis antigen HuD, one of the neuronal members of the Hu family. The neuronal Hu proteins play important roles in neuronal differentiation, plasticity and memory. HuD has been implicated in various aspects of neuronal function, such as the commitment and differentiation of neuronal precursors as well as synaptic remodeling in mature neurons. HuD also functions as an important regulator of mRNA expression in neurons by interacting with AU-rich RNA element (ARE) and stabilizing multiple transcripts. Moreover, HuD regulates the nuclear processing/stability of N-myc pre-mRNA in neuroblastoma cells, as well as the neurite elongation and morphological differentiation. HuD specifically binds poly(A) RNA. Like other Hu proteins, HuD contains three RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). RRM1 and RRM2 may cooperate in binding to an ARE. RRM3 may help to maintain the stability of the RNA-protein complex, and might also bind to poly(A) tails or be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 410163
Aligned: 6 rows
Threshold Bit Score: 153.726
Created: 15-Sep-2011
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
RNA binding
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:RNA binding site [nucleic acid binding site]
Evidence:
  • Structure:1FXL_A; Homo sapiens HuD protein in complex with AU-rich element, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #    #  #                    #                                           #    
1FXL_A         2 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKIt-----------------------------GQSLGYGFVNYI 52  human
NP_990161     50 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKIt-----------------------------GQSLGYGFVNYI 100 chicken
Q7SZT7        50 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKItgtqfeenfkdlatgtkwkplteegpifgkGQSLGYGFVNYI 129 African clawed ...
NP_571528     79 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKIt-----------------------------GQSLGYGFVNYI 129 zebrafish
XP_014348770  38 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKIt-----------------------------GQSLGYGFVNYI 88  coelacanth
XP_007901849  45 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKIt-----------------------------GQSLGYGFVNYV 95  elephant shark
Feature 1                           ## #    # #
1FXL_A        53 DPKDAEKAINTLNGLRLQTKTIKVSYARPS 82  human
NP_990161    101 DPKDAEKAINTLNGLRLQTKTIKVSYARPS 130 chicken
Q7SZT7       130 DPKDAEKAINTLNGLRLQTKTIKVSYARPS 159 African clawed frog
NP_571528    130 DPKDAEKAINTLNGLRLQTKTIKVSYARPS 159 zebrafish
XP_014348770  89 DPKDAEKAINTLNGLRLQTKTIKVSYARPS 118 coelacanth
XP_007901849  96 DPKDAEKAINTLNGLRLQTKTIKVSYARPS 125 elephant shark

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap