2EK6,2CQP,2EK1


Conserved Protein Domain Family
RRM5_RBM12

?
cd12751: RRM5_RBM12 
Click on image for an interactive view with Cn3D
RNA recognition motif 5 (RRM5) found in RNA-binding protein 12 (RBM12) and similar proteins
This subgroup corresponds to the RRM5 of RBM12, also termed SH3/WW domain anchor protein in the nucleus (SWAN), which is ubiquitously expressed. It contains five distinct RNA binding motifs (RBMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), two proline-rich regions, and several putative transmembrane domains. The biological role of RBM12 remains unclear.
Statistics
?
PSSM-Id: 410145
Aligned: 8 rows
Threshold Bit Score: 150.038
Created: 4-Oct-2011
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interface
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2EK6; Human RNA12 forms a dimer of dimer, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    ######                # #  ##                                    
2EK6_A         15 PTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGmPTGEAMVAFESrDEATAAVIDLNDRPIGSRKVKLS 90   human
AAP69824      800 PTVIRVQNMPFTVTVDEILDFFYGYQLIPGSVCLKFSDKGmPTGEAMVAFESrDEAMAAVVDLNERPIGSRKVKLT 875  African clawed frog
NP_001003856  799 PTIVKIQNMPFTVTVDEIIDFFYGYQVLPGSVCLQFSDKGlPTGEAMVAFDShDEAMAAVMDLNDRPIGARKVKIT 874  zebrafish
2CQP_A         15 PTIIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGmPTGEAMVAFESrDEATAAVIDLNDRPIGSRKVKLV 90   house mouse
2EK1_A         15 PTVIKVQNXPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGxPTGEAXVAFESrDEATAAVIDLNDRPIGSRKVKLS 90   human
NP_996869     803 PTVIKVQNMPFTVSVDEILDFFYGYQVIPGSVCLKYNEKGmPTGEAMVAFESrDEAMAAVVDLNDRPIGSRKVKLV 878  chicken
XP_005986784  959 PTVIKVQNMPFAVSVDEVVDFFYGYKVIPGSVCLKYNEIGmPTGEAMVAFESrDEAMAAVVDLNDRPIGSRKVKLV 1034 coelacanth
XP_007910685  761 PTVVKVQNLPFKVSVDEILDFFYGYRVIPDSVCLQFNEQGmPTGEAMVAFEScDEAMSAVVDLSDRPIGSRKVKLV 836  elephant shark

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap