Conserved Protein Domain Family
RRM2_RBM12B

?
cd12746: RRM2_RBM12B 
RNA recognition motif 2 (RRM2) found in RNA-binding protein 12B (RBM12B) and similar proteins
This subgroup corresponds to the RRM2 of RBM12B which contains five distinct RNA binding motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). Its biological role remains unclear.
Statistics
?
PSSM-Id: 410140
Aligned: 5 rows
Threshold Bit Score: 162.61
Created: 22-Sep-2011
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8IXT5        153 ENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFIEVMQGSEQQ 232  human
NP_001026115  172 DDLYLFLRGIPYSATEDAVRDFLSGIRVDGVILIKHRNGLNNGNCLVKFATPGDALEGLKRHRQYMGQRFIEISPTTEER 251  chicken
XP_006008447  180 DDLFLFLCGMPYSVTESDVRTFFQGLSVDGVILLKDLQGRNNGYGLVKFATYEDAMEGIKRDKQYIGSRYVKVNRANEKR 259  coelacanth
XP_018415692  151 DDVYVFMYGLPYSATEEEVRKFFSGIDVVEVLFLLRPNGLRNGNGLVKFGSAKDASAALERHNQYIGDRFISLKKTTEEQ 230  Nanorana parkeri
NP_001277069  154 AEVYLKLTGMPFSATKDNVHNFFAGLKVDDILFLKNPRGMFSGNSMVRFTTKEDAIEGLKRDRQYMGSRYIQITRCTEEE 233  zebrafish
Q8IXT5        233 WIEFGG 238  human
NP_001026115  252 WIEYGG 257  chicken
XP_006008447  260 WISAGG 265  coelacanth
XP_018415692  231 WVTAGG 236  Nanorana parkeri
NP_001277069  234 WLKEGG 239  zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap