Conserved Protein Domain Family
RRM_TNRC6B

?
cd12712: RRM_TNRC6B 
RNA recognition motif (RRM) found in vertebrate trinucleotide repeat-containing gene 6B protein (TNRC6B)
This subgroup corresponds to the RRM of TNRC6B, one of three GW182 paralogs in mammalian genomes. It is involved in miRNA-mediated mRNA degradation. TNRC6B is composed of an N-terminal glycine/tryptophan (G/W)-rich region; a ubiquitin-associated (UBA) domain and a glutamine (Q)-rich region in the middle region; a middle G/W-rich region, a RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and a C-terminal G/W-rich region, at the C-terminus. TNRC6B directly interacts with Argonaute (Ago) proteins through its N-terminal glycine/tryptophan (G/W)-rich region that is called Ago protein-binding domain. TNRC6B is enriched in P-bodies and its Q-rich domain is responsible for P-body localization. A bipartite C-terminal region including the middle and C-terminal G/W-rich regions is referred as silencing domain that triggers silencing of bound transcripts by inhibiting protein expression and promoting mRNA decay via deadenylation. The C-terminal half of TNRC6B comprising an RRM domain exerts a strong translation inhibition potential, which does not require either association with Agos or localization to P-bodies.
Statistics
?
PSSM-Id: 410111
Aligned: 6 rows
Threshold Bit Score: 184.109
Created: 15-Sep-2011
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9UPQ9       1647 SYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRF 1726 human
XP_002663990 1777 SCWLVLSNLTPQIDGSTLRTICMQHGPLLTFHLGLTQGSALIRYSSRQEAAKAQSALHMCVLGNTTILAEFVSEEEVARY 1856 zebrafish
XP_003221033  843 SYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDEEVSRF 922  green anole
XP_014347473 1772 SCWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLNLTQGTALIRYNSKQEAAKAQTALHMCVLGNTTILAEFAPEDEVNRY 1851 coelacanth
OCA38956      415 SYWLILLNLTPQIDGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQSALHMCVLGNTTILAEFATDEEVSRY 494  tropical claw...
XP_007907968 1701 SSWLVLHNLTPQIDGSTLRTICMQHGPLITFHLNLTHGTALVRYSTKQEAAKAQTALHMCVLGNTTILAEFVSEEEVNRY 1780 elephant shark
Q9UPQ9       1727 LAQ 1729 human
XP_002663990 1857 FAH 1859 zebrafish
XP_003221033  923 LAQ 925  green anole
XP_014347473 1852 FAQ 1854 coelacanth
OCA38956      495 LAQ 497  tropical clawed frog
XP_007907968 1781 FAQ 1783 elephant shark
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap