Conserved Protein Domain Family
RRM_TNRC6A

?
cd12711: RRM_TNRC6A 
RNA recognition motif (RRM) found in vertebrate GW182 autoantigen
This subgroup corresponds to the RRM of the GW182 autoantigen, also termed trinucleotide repeat-containing gene 6A protein (TNRC6A), or CAG repeat protein 26, or EMSY interactor protein, or protein GW1, or glycine-tryptophan protein of 182 kDa, a phosphorylated cytoplasmic autoantigen involved in stabilizing and/or regulating translation and/or storing several different mRNAs. GW182 is characterized by multiple glycine/tryptophan (G/W) repeats and is a critical component of GW bodies (GWBs, also called mammalian processing bodies, or P bodies). The mRNAs associated with GW182 are presumed to reside within GWBs. GW182 has been shown to bind multiple Ago-miRNA complexes, and thus plays a key role in miRNA-mediated translational repression and mRNA degradation. In the absence of Ago2, GW182 may induce translational silencing effect. GW182 is composed of an N-terminal G/W-rich region containing an Ago hook responsible for Ago protein-binding; a ubiquitin-associated (UBA) domain and a glutamine (Q)-rich region in the middle region; a middle G/W-rich region, a RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and a C-terminal G/W-rich region, at the C-terminus. A bipartite C-terminal region including the middle and C-terminal G/W-rich regions is referred to as silencing domain that triggers silencing of bound transcripts by inhibiting protein expression and promoting mRNA decay via deadenylation.
Statistics
?
PSSM-Id: 410110
Aligned: 6 rows
Threshold Bit Score: 184.513
Created: 15-Sep-2011
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8NDV7       1775 SSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNALVRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEE 1854 human
CAG02698     1657 SSSGRTQWLVLKNLTPQIDGSTLKTLCMQHGPLITFHLNLPHGNAVVCYSSKDEAAKAQKSLHMCVLGNTTILAEFASEE 1736 spotted green...
KFO05103      164 SSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNALVRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEE 243  East African ...
XP_007904008 1904 SSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNALVCYSSKEEAAKAQKSLHMCVLGNTTILAEFASED 1983 elephant shark
XP_014345416 1684 SSGRTTNWLVLKNLTPQIDGSTLRTLCLQHGPLITFHLNLPHGNALVRYSSKEEAIKAQKSLHMCVLGNTTILAEFASEE 1763 coelacanth
OCT64363     1627 SSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGTALVRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEE 1706 African clawe...
Q8NDV7       1855 EISRFFAQSQSL 1866 human
CAG02698     1737 EINRFFAQGQSL 1748 spotted green pufferfish
KFO05103      244 EISRFFAQGQSL 255  East African grey crowned-crane
XP_007904008 1984 EINRFFAQGQSL 1995 elephant shark
XP_014345416 1764 EISRFFAQGQSL 1775 coelacanth
OCT64363     1707 EISRFFAQGQSL 1718 African clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap