Conserved Protein Domain Family
RRM4_ROD1

?
cd12703: RRM4_ROD1 
RNA recognition motif 4 (RRM4) found in vertebrate regulator of differentiation 1 (Rod1)
This subgroup corresponds to the RRM4 of ROD1 coding protein Rod1, a mammalian polypyrimidine tract binding protein (PTB) homolog of a regulator of differentiation in the fission yeast Schizosaccharomyces pombe, where the nrd1 gene encodes an RNA binding protein that negatively regulates the onset of differentiation. ROD1 is predominantly expressed in hematopoietic cells or organs. It might play a role controlling differentiation in mammals. Rod1 contains four repeats of RNA recognition motifs (RRM), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain) and does have RNA binding activities.
Statistics
?
PSSM-Id: 410102
Aligned: 3 rows
Threshold Bit Score: 184.501
Created: 14-Sep-2011
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
 
putative RNA
Feature 1:putative RNA binding site [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to Homo sapiens polypyrimidine tract binding protein.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        # ##                        ###### ## #                #      # 
O95758       462 PGSKNFQNIFPPSATLHLSNIPPSVTVDDLKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENH 541 human
NP_001120518 429 PGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQKDRKMALIQLGSVEEAILALIELHNHDLGENH 508 western clawed ...
XP_014342434 432 PGSKNFQNIFPPSATLHLSNIPPSVTDDELKSLFASTGCAVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENH 511 coelacanth
Feature 1          ######## 
O95758       542 HLRVSFSKSTI 552 human
NP_001120518 509 HLRVSFSKSMI 519 western clawed frog
XP_014342434 512 HLRVSFSKSTI 522 coelacanth

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap