Conserved Protein Domain Family
RRM_U2AFBPL

?
cd12540: RRM_U2AFBPL 
RNA recognition motif (RRM) found in U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL) and similar proteins
This subgroup corresponds to the RRM of U2AFBPL, a human homolog of the imprinted mouse gene U2afbp-rs, which encodes a U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL), also termed CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 1 (U2AF1RS1), or U2 small nuclear RNA auxiliary factor 1-like 1 (U2AF1L1). Although the biological role of U2AFBPL remains unclear, it shows high sequence homology to splicing factor U2AF 35 kDa subunit (U2AF35 or U2AF1) that directly binds to the 3' splice site of the conserved AG dinucleotide and performs multiple functions in the splicing process in a substrate-specific manner. Like U2AF35, U2AFBPL contains two N-terminal zinc fingers, a central RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and a C-terminal arginine/serine (SR)-rich domain.
Statistics
?
PSSM-Id: 409956
Aligned: 16 rows
Threshold Bit Score: 152.804
Created: 15-Sep-2011
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q15695       204 TLLIKSMFTTFgmeqcrrddy------dpdasleysEEETYQQFLDFYEDVLPEFKNvGKVIQFKVSCNLePHLRGNVYV 277 human
CAF99810     188 TLMIRSMFKTFgmeearrddy------dmdaclehsEEELYESFLEFYHDVLPEFKSvGKVLQFKVSCNHePHLRGNVYV 261 spotted green p...
XP_002593322 157 TLLIAGMFATFaldqtqrddf------detmyleygEDELYKDFIEFYNDTLPEFRTlGRVVQFKVCCNHePHLRGNVYV 230 Florida lancelet
NP_001123327 238 TLLLPSMFNTFafdiasrasrsnvhgdssdlalehsDEDLYEDFEVFYDDVFPEFNKfGHVEQLKVCCNRdQHLRGNVYV 317 Ciona intestinalis
Q9SY74       273 TLLMKNMYNGPgitweqd------------egleytDEEAELCYEEFYEDVHTEFLKyGELVNFKVCRNGsFHLKGNVYV 340 thale cress
NP_608857    197 ILLIRHFFNHSmlqkrcthkey----asaeehleltEQDLRHDYDEFFNDVVEELRKfGTIVNFRTVRNTlEHLRGHVFV 272 fruit fly
EAA13785     193 VILIPNFFSHPaleqavhaey------ghdarlefdEDDLKNSYNEFFRDIIQEFEMfGTVRHIFVCRNSvAHLRGSVYI 266 Anopheles gambi...
EEB12046     197 TLLVSNFYSHFtleqnkssey------dtdiileyeDSDMYSHFKEFYTDIVPEFKKfGDLTMVKVCCNSePHLRGNVYI 270 human body louse
XP_002739620  61 TLVIPKMFSNFsmeqcmrdey------dtdiclefdEKDAYADFLSFYDDVLGEFRAlGEVIQFKVCCNWePHLRGNVYV 134 Saccoglossus ko...
XP_018101525 219 TLLIRSMFVTFgmeqcrrddy------dtdasleygDEEIYQHFLEFYADVVPEFKSvGKVVQFKVSCNFeLHLRGNVYV 292 African clawed ...
Q15695       278 QYQSEEECQAALSLFNGRWYAGRQLQCEFCP 308 human
CAF99810     262 QFGSEEQCKEALIKFNGRWYAGRQLHCEMCP 292 spotted green pufferfish
XP_002593322 231 QYEREEDCLEAIRKFHGRFYAGKQLTCEMTP 261 Florida lancelet
NP_001123327 318 QYATVSQAETAFQSLNGRFYGGKLLQCMYVT 348 Ciona intestinalis
Q9SY74       341 HYRSLESAILAYQSINGRYFAGKQVNCEFVN 371 thale cress
NP_608857    273 EYTNERSALRAFTNLQGRYYASKRLNVEFSN 303 fruit fly
EAA13785     267 EYESMRNAAAAYLRMNGRFYAKKQLHVEFRN 297 Anopheles gambiae str. PEST
EEB12046     271 EYKHKKDALLAYKEFQGRWYGDWGGAVCGDF 301 human body louse
XP_002739620 135 QYNSEDECSKAISMFNGRYYAGKQLTCLYCP 165 Saccoglossus kowalevskii
XP_018101525 293 QYQTEEECLKAFTQFNGRWYASRQLQCEFSP 323 African clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap