1Z3Q,2AHN


Conserved Protein Domain Family
Thaumatin-like

?
cd09215: Thaumatin-like 
Click on image for an interactive view with Cn3D
the sweet-tasting protein, thaumatin, and thaumatin-like proteins involved in host defense
This family is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii and thaumatin-like proteins (TLPs) involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs included in this family are such proteins as zeamatin, found in high concentrations in cereal seeds; osmotin, a salt-induced protein in osmotically stressed plants; and PpAZ44, a propylene-induced TLP in abscission of young fruit. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). Thaumatin and TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Most TLPs contain 16 conserved Cys residues. A deletion within the third domain (domain II) of the Triticum aestivum thaumatin-like xylanase inhibitor is observed, thus, only 10 conserved Cys residues are present within this smaller TLP and similar homologs.
Statistics
?
PSSM-Id: 185754
Aligned: 6 rows
Threshold Bit Score: 191.124
Created: 25-Aug-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
electronegati..
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:electronegative/electropositive cleft residues
Evidence:
  • Comment:Thaumatin-like proteins are crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II.
  • Comment:It has been proposed that the antifungal activity of plant PR5 proteins (pathogenesis-related protein family 5) relies on the strong electronegative character of the cleft with conserved cleft residues: Arg, Glu, Asp, and Asp.
  • Comment:Sweet-tasting protein thaumatin has an electropositively charged cleft (with conserved cleft residues Lys, Glu, Asp, and Lys, instead of Arg, Glu, Asp, and Asp) and lacks antifungal activity.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                        #                            
1Z3Q_A      3 FEIVNRCsYTVWAAAVp-----------gGGRQLNqgQSWTINVNAgttGGRIWGRTGCsfdg------------sgrGR 59  Musa acuminata
BAE95856   24 FTVYNGCpFTIWPAMFtgvnqataspaytTGWAANayTAVSFSVPDnwqAGRIWARRDCdfsv-----------npgpNS 92  shiitake mushroom
2AHN_A      3 ISFKNNCpYMVWPGTLtsdqk---pqlstTGFELAsqASFQLDTPVp-wNGRFWARTGCstda------------sgkFV 66  sweet cherry
EAA35497  137 LVITNSCpDTIWPGIGtqngi----gpevGGFELApgETKPLFVSPd-wQGRVWGRTNCsfnadgtgpsnlngvngngAA 211 Neurospora crassa ...
EAT90603   59 LLVTNRCpGDIWPGIStqsgk----gpkeNGFKLQpgETKNQTVSEd-wQGRVWGRTNCtfnsdgt-----gpasgsgKA 128 Phaeosphaeria nodo...
EEA26283   46 FRITNHCpVDIYPAIQtqagt----gpafGGYHALpgNTTSFDVSAg-wQGRIWARTNCtfnengm-----stngmgaDA 115 Penicillium marnef...
Feature 1                                #              #    #                                
1Z3Q_A     60 CQTGDCgg-vlSCTAYgn---pPNTLAEFALnqf--nnlDFFDISLVDGFNVPMDFSPts--ggCRGIRCAAdingqcpg 131 Musa acuminata
BAE95856   93 CLDGGCng-glVCDPTtgtgvpPASLAEFTLsga--gglDYFDISFVDGYNLPISITNnv---nCPAPICAVdlgpncpa 166 shiitake mushroom
2AHN_A     67 CATADCasgqvMCNGNga--ipPATLAEFNIpag--ggqDFYDVSLVDGFNLPMSVTPqggtgdCKTASCPAnvnavcps 142 sweet cherry
EAA35497  212 CMTGDCfg-rlNCEFTgq---vPVTLAEFNLlgginsdqTFYDISLVDGYNLPLGIIYip--aaNTTWIPPNltncvcia 285 Neurospora crassa ...
EAT90603  129 CYSGDCng-ilNCQVGgd---vPVSLAEFTLdag--dghTYYDISLVDGYNVPIAIVLqp--leNITLDDIPpnltnpsc 200 Phaeosphaeria nodo...
EEA26283  116 CLTGDCgg-llDCQGTg----kPATLAEFTMsgs--mnlSYYDISLVDGYNLPLGIISlh--ieSSDPDLKNipsnttnp 186 Penicillium marnef...
Feature 1                                                                                     
1Z3Q_A    132 alkapggcnnpctvfk---------------------------------------------------------------- 147 Musa acuminata
BAE95856  167 plagpfdstgfpvgcksacdanldg------------------------------------------------------- 191 shiitake mushroom
2AHN_A    143 elqkkgsdgsvvaclsacvkf----------------------------------------------------------- 163 sweet cherry
EAA35497  286 sagfldppsrsglyytnktfpipwesdqtnpsvggwcpwdlqeyppskp------------gdgiypypddsiqrpvfdp 353 Neurospora crassa ...
EAT90603  201 qgtdgllaaqdynpypeypdflrtntsyplpfdkkvdqnqiskwcpwdlqqtp----pdkpgdgvypypddniqrpqfnp 276 Phaeosphaeria nodo...
EEA26283  187 vcigspnflqatnqlengttvpsnstigsitystplemtlsthavsqwcpwplqiqpppkpgagvypypddgiarpdfdp 266 Penicillium marnef...
Feature 1                                                                           
1Z3Q_A    148 --------------tdqyccnsgacsptdysqffkrnCPDAYSYpkdd--qttTFTCPg--GTNYRVVFC 199 Musa acuminata
BAE95856  192 ----dqqnspnccsgqydtpatcpvsgveyytyfkdaCPDAYAYaydessesaLWTCAdslNADYTITFC 257 shiitake mushroom
2AHN_A    164 --------gtpqycctppqntpetcpptnyseifhnaCPDAYSYaydd--krgTFTCNg--GPNYAITFC 221 sweet cherry
EAA35497  354 clsacaatgnpedcctgkyddpsvctpslysenaktvCPDAYSYafdd--qtsTFIIPn--GGGWEVVFC 419 Neurospora crassa OR74A
EAT90603  277 cfsacaknnkpeecctgeynspskchvseysknvkavCPDAYSFafdd--qtsTFIIPs--GAGFEVVFC 342 Phaeosphaeria nodorum SN15
EEA26283  267 clslcsrygksnycctgkhgtadkcspnmyskaakkvCPDAYSYaydd--ttsTFTVKq--GAGFEVVFC 332 Penicillium marneffei ATCC 1...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap