1LN1,1LN3


Conserved Protein Domain Family
START_STARD2-like

?
cd08910: START_STARD2-like 
Click on image for an interactive view with Cn3D
Lipid-binding START domain of mammalian STARD2 and related proteins
This subgroup includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of STARD2 (also known as phosphatidylcholine transfer protein/PC-TP) and related proteins. It belongs to the START domain family, and in turn to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD2 is a cytosolic phosphatidycholine (PtdCho) transfer protein, which traffics PtdCho, the most common class of phospholipids in eukaryotes, between membranes. It represents a minimal START domain structure. STARD2 plays roles in hepatic cholesterol metabolism, in the development of atherosclerosis, and may have a mitochondrial function.
Statistics
?
PSSM-Id: 176919
View PSSM: cd08910
Aligned: 6 rows
Threshold Bit Score: 381.454
Threshold Setting Gi: 37654722
Created: 19-May-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
PtdCho binding
Conserved site includes 27 residues -Click on image for an interactive view with Cn3D
Feature 1:PtdCho binding site
Evidence:
  • Comment:phosphatidylcholine (PtdCho)
  • Structure:1LN3_A; human STARD2(PC-TP) binds palmitoyl-linoleoyl-PtdCho, contacts at 4A.
    View structure with Cn3D
  • Structure:1LN1_A; human STARD2(PC-TP) binds di-linoleoyl-PtdCho, contacts at 4A.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                     ##      #            # #           #   #     #     
1LN1_A         4 AAGSFSEEQFWEACAELQQPALAGadWQLLVETSGISIYRLLDKkTGLYEYKVFGVLEDcSPTLLADIYMDsDYRKQWDQ 83  human
1LN3_A         4 AAGSFSEEQFWEACAELQQPALAGadWQLLVETSGISIYRLLDKkTGLYEYKVFGVLEDcSPTLLADIYXDsDYRKQWDQ 83  human
XP_415652      5 PRRGFSEEQFRAACSELGQTAPGPp-WQLLVESMGVSIYRLYDEqSGLYEYKIFGGLADcPPKLCADVYMDlEYRKQWDQ 83  chicken
XP_001368863   3 RQGDFSEEEFRKACAELENPASDGkaWESLVESESCNIYQMLDEqSGFYNYKAFGDFKDcSPSLYAEVYMDlEYRKQWDA 82  gray short-tail...
AAQ96655       2 AVVTFEDEEFEKVCKELQSPELDGg-WEFFTESHDVQIHRLYREeSGLYEYKVLGMLSDvSPSVCADVYMDlEYRKKWDS 80  Branchiostoma b...
NP_001077150   4 GTGTFSEEQFREACAELQRPALSGaaWELLMETQGISVYGLLDQpTGLYEYKLIGTLRA-PPDILADICMDlGYIRRRIP 82  cattle
Feature 1        #                # # #        # #                                      # # #    
1LN1_A        84 YVKELYEQECNGETVVYWEVKYPFpMSNRDYVYLRQRRDLDMeGRKIHVILARSTSMPQLGERsGVIRVKQYKQSLAIES 163 human
1LN3_A        84 YVKELYEQECNGETVVYWEVKYPFpXSNRDYVYLRQRRDLDXeGRKIHVILARSTSXPQLGERsGVIRVKQYKQSLAIES 163 human
XP_415652     84 YVKELYEKTYDGEKIIYWEVKYPFpLSNRDYVYIRECQEMDVdGRKIWVALARSVSVPQCPEKpGIIRVKSYKQSLAIES 163 chicken
XP_001368863  83 YVKELYEKEICGKMVIYWEVKYPFpVSNRDYVYIRDGRDINLnGRMVRVILAKSFSTPEIPEKcGVIRVSDYRQSLVIES 162 gray short-tail...
AAQ96655      81 YVNELYEREVEGKKVIYWNVNFPMfMSNRDYVYMRELREFDVeYGHVWAVLAQSTTLGNVPEKdGVIRVDDYKCSLVFAS 160 Branchiostoma b...
NP_001077150  83 QVTEAYETECDGETVTYMKMEFPFlLSSRDCVYVKQRRDLDFrGQKIQVVLAKGTSLPQFPERpGFIRVSQCQVKLAVES 162 cattle
Feature 1               # # #              ###   #  ##  #       
1LN1_A       164 DGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNY 210 human
1LN3_A       164 DGKKGSKVFXYYFDNPGGQIPSWLINWAAKNGVPNFLKDXARACQNY 210 human
XP_415652    164 DGKTGSKVYMYYFDNPGGMIPSWLVNWAAKSGVPAFLKDMQKACCNY 210 chicken
XP_001368863 163 NGKEGCKVSMFYHDNPGGTIPSWLVNWIAKNGVPNFLQDIQKACKNY 209 gray short-tailed opossum
AAQ96655     161 DGKQGTKAFMYYYDNPKGMIPTFIINWAAKTGVPGFLTSMQKACRKY 207 Branchiostoma belcheri tsingtauense
NP_001077150 163 AGHNRSKVFIYCFINPGGWIPSWLINMVAKSAIPGFLADLEDACLKY 209 cattle

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap