2PSO


Conserved Protein Domain Family
START_STARD13-like

?
cd08909: START_STARD13-like 
Click on image for an interactive view with Cn3D
C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain
This subgroup includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of STARD13 (also known as DLC-2, Arhgap37, and SDCCAG13) and related proteins. It belongs to the START domain family, and in turn to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Proteins belonging to this subfamily also have a RhoGAP domain. The precise function of the START domain in this subgroup is unclear.
Statistics
?
PSSM-Id: 176918
View PSSM: cd08909
Aligned: 4 rows
Threshold Bit Score: 435.885
Threshold Setting Gi: 47227849
Created: 19-May-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative lipid
Conserved site includes 44 residues -Click on image for an interactive view with Cn3D
Feature 1:putative lipid binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                        ##       #            # #          #   #   #  ## 
2PSO_A         24 EESGATFHTYLNHLIQGLQKEAKEKFKGWVTCSSTDNTDLAFKKVGDGNPLKLWKASVEVEAPPSVVLNRVLRERHLWDE 103  human
XP_417104     903 DEEGGNYQMYLESLMQNLHKEAKEKFKGWVTCSSMENTELAYKKVGDGNPLRLWKASVEVEAPPSVVLNRVLRERHLWDE 982  chicken
NP_001089169  788 EEEGGNVSTYFESTIQGLQKEAKEKFKGWISLSSAENTDLAYKKVGDGNPLRLWKVSVEVEAPPSVVLNHILRERQLWDD 867  African clawe...
CAG09012      843 EDDDGTYQTHMEGRLHNLLKEAREKSKYWISCSSSDNTELYCKKVGDGNPLRRWRVSVEVEAPPSVVLNRVLRERHLWDV 922  Tetraodon nig...
Feature 1         ##                 # ####  #  # # #                #               # #### #     
2PSO_A        104 DFVQWKVVETLDRQTEIYQYVLNSMAPHPSRDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQLLGGVRAVVMDSQYLIEPC 183  human
XP_417104     983 DFLQWKVVESLDKQTEVYHYVLNSMAPHPVRDFVVLRTWRTDLPRGTCMLVAISVEHEEAPLMGAVRAIVMDSQYLIEPC 1062 chicken
NP_001089169  868 DFLQSKVVETLDNQTEVYQYVLNCMAPHPSRDFVVLRSWRTDLPKGICALAAVSVEHDEANLIGGVRAAVLDTRFLIEPC 947  African clawe...
CAG09012      923 DLLQWKVYETLDKQTEVFQYALSCMPPHPSREFLVLRSWRTDLPKGACSLVSVSIEMEDCPPLGGVRAVVLESNYLLEPC 1002 Tetraodon nig...
Feature 1               # # # # # #      # ### ### ##  #       
2PSO_A        184 GSGKSRLTHICRIDLKGHSPEWYSKGFGHLCAAEVARIRNSFQPL 228  human
XP_417104    1063 GSGKARLTHICRIDLKGHSPEWYNKGFGHLCAAEVARIRNSFQPL 1107 chicken
NP_001089169  948 GSGKSKLTHICRVDLKGHSPEWYNKCFGHLCASEALRIRNSFQPI 992  African clawed frog
CAG09012     1003 GSGKSRLTHISRVDMKGRTPDWYNKAFGHLCAAEAARIRNSFQPL 1047 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap