Conserved Protein Domain Family
START_STARD12-like

?
cd08908: START_STARD12-like 
C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain
This subgroup includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of STARD12 (also known as DLC-1, Arhgap7, and p122-RhoGAP) and related proteins. It belongs to the START domain family, and in turn to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Proteins belonging to this subgroup also have an N-terminal SAM (sterile alpha motif) domain and a RhoGAP domain, and have a SAM-RhoGAP-START domain organization. The precise function of the START domain in this subgroup is unclear.
Statistics
?
PSSM-Id: 176917
View PSSM: cd08908
Aligned: 3 rows
Threshold Bit Score: 439.833
Threshold Setting Gi: 1083784
Created: 19-May-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative lipid
Feature 1:putative lipid binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                     ##       #            # #          #   #   #  ## 
Q96QB1    1315 NDDSADYQHFLQDCVDGLFKEVKEKFKGWVSYSTSEqAELSYKKVSEGPPLRLWRSVIEVPAVPEEILKRLLKEQHLWDV 1394 human
1083784    870 NDQPADYRHFLQDCVDGLFKEVKEKFKGWVSYPTSEqAELSYKKVSEGPPLRLWRATIEVPAAPEEILKRLLKEQHLWDV 949  Norway rat
XP_420693 1362 TMEPSDYHCYLQDCMDDLLKEMKEKFKGWVSCSTSEqADLAYKKACEGPPLRLWKTTIEIAAAPEEVLNRLLKEQHLWDE 1441 chicken
Feature 1      ##                 # ####  #  # # #                #              # #### #      
Q96QB1    1395 DLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALLLTSVDHDRAPVVGVRVNVLLSRYLIEPCG 1474 human
1083784    950 DLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPRGACALLFTSVDHDRAPVAGVRVNVLLSRYLIEPCG 1029 Norway rat
XP_420693 1442 DLIDSKVIEPLDSQTDIYQYVQNSMAPHPARDFVILRTWRTNFPKGACVLLATSVDHDRAPVAGVRVNVLLSRYLIEPCG 1521 chicken
Feature 1           # # # # # #      # ### ### ##  #       
Q96QB1    1475 PGKSKLTYMCRVDLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQ 1518 human
1083784   1030 SGKSKLTYMCRADLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQ 1073 Norway rat
XP_420693 1522 SGKSKLTYMCRIDLRGHMPDWYTKCFGHLCASEVVKIRDSFTHQ 1565 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap