Conserved Protein Domain Family
START_STARD8-like

?
cd08907: START_STARD8-like 
C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain
This subgroup includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of STARD8 (also known as deleted in liver cancer 3/DLC3, and Arhgap38) and related proteins. It belongs to the START domain family, and in turn to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Proteins belonging to this subfamily also have a RhoGAP domain. The precise function of the START domain in this subgroup is unclear.
Statistics
?
PSSM-Id: 176916
View PSSM: cd08907
Aligned: 3 rows
Threshold Bit Score: 430.882
Threshold Setting Gi: 31543659
Created: 19-May-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative lipid
Feature 1:putative lipid binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                        ##       #            # #          #   #   #  ## 
NP_055540     810 QAAGVSLSLYMEENIQDLLRDAAERFKGWMSVPGPqHTELACRKAPDGHPLRLWKASTEVAAPPAVVLHRVLRERALWDE 889  human
AAI33139      863 LGEPVDYRAYLEDNVQCLLREASERSKGWHHAHGPdNTELAYKKVGDGHPMRIWRVSVEIEAPPSVVLQRVLRERHLWDE 942  zebrafish
XP_001232150  838 QGEGKDLHSYFEQSVRNLLKESSEKFKGWLSTPGPlNTELSCKKVGDGHPLRLWKVSTEVEAPPSTVLQRVLRERHLWDE 917  chicken
Feature 1         ##                 # ####  #  # # #                #               # #### #     
NP_055540     890 DLLRAQVLEALMpgVELYHYVTDSMAPHPCRDFVVLRMWRSDLPRGGCLLVSQSLDpEQPVPESGVRALMLTSQYLMEPC 969  human
AAI33139      943 DLLHSRVIETLEnnTEVFHYITDSMAPHPRRNFITLRRWCSDLPKGVCVLVSSSVDhDNVQLEAGLRAVLLTSRMFIEPC 1022 zebrafish
XP_001232150  918 DLLQSKVVEALDknMEVYHYVTDSMAPHPRRDCVVLRCWRTDLPRGACLLISISVEhDKLQVEGGVKAVVLTSQYLIEPN 997  chicken
Feature 1               # # # # # #      # ### ### ##  #       
NP_055540     970 GLGRSRLTHICRADLRGRSPDWYNKVFGHLCAMEVAKIRDSFPTL 1014 human
AAI33139     1023 GMGRSRLTHYCRADLRGRSPDWYNKVFGHLCAMEVARIRSSFPVL 1067 zebrafish
XP_001232150  998 GMGRSKVTHICRADLRGRSPEWYNKVFGHLCAMELVRIRDSFPAL 1042 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap