Conserved Protein Domain Family
START_STARD6-like

?
cd08904: START_STARD6-like 
Lipid-binding START domain of mammalian STARD6 and related proteins
This subgroup includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD6 and related domains. It belongs to the START domain family, and in turn to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD6 is expressed in male germ cells of normal rats, and in the steroidogenic Leydig cells of perinatal hypothyroid testes. It may play a pivotal role in the steroidogenesis as well as in the spermatogenesis of normal rats. STARD6 has also been detected in the rat nervous system, and may participate in neurosteroid synthesis.
Statistics
?
PSSM-Id: 176913
View PSSM: cd08904
Aligned: 3 rows
Threshold Bit Score: 407.371
Threshold Setting Gi: 149409780
Created: 19-May-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative lipid
Feature 1:putative lipid binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                  ##      #            # #          #   #     #  ## ##  
AAL89655       1 MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFhGNLYRVEGIIPESPAKLSDFLYqTGDRITWDKSLQV 80  human
XP_001362749   1 MDFKKLADEVSQEVLAFSRDTSGWKVTKTSKKITVSWKPSRNYdGHLYRAEGIIPETPAKLIQFMYlPEHRSKWDRSLHT 80  gray short-tail...
XP_001509673   1 MDFKKIAEEISQKILSYSRDTSGWKVAKTSKKITVSWKPSKEYgGNLYRGEGVIKEAPAKLIQFMYfPEHRTKWDKSLQI 80  platypus
Feature 1                       # ####    #  # # #               #                # #### #       
AAL89655      81 YNMVHRIDsDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGnMNIISSKSVDFPEYPPssNYIRGYNHPCGFVCSPMeE 160 human
XP_001362749  81 YKMLQRIDsDTFILHTITNSFAMGSIAPRDFVDLVHIKYYEGeKVIVSAVSVEYPQCPPtsTYIRGYNNPCGYVCSPLpE 160 gray short-tail...
XP_001509673  81 YKLLQRIDaDTFICHTVTHSFGMGSISPRDFVDLVHIKVYEGdVSIVSSVSVEYPQCCPssSCIRGYNHPCGYVCSPLpE 160 platypus
Feature 1              # # # # # #      # ### ###  ##  #     
AAL89655     161 NPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIK 204 human
XP_001362749 161 NPGYSKLVMYVQPELKGNLSRAVVEATMPTNLLNLIHDAKDGIK 204 gray short-tailed opossum
XP_001509673 161 NPSYSRLVVFVQPELGGNLPRPVIESALPTSLINLIGDLKDGIK 204 platypus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap