1JSS


Conserved Protein Domain Family
START_STARD4-like

?
cd08902: START_STARD4-like 
Click on image for an interactive view with Cn3D
Lipid-binding START domain of mammalian STARD4 and related proteins
This subgroup includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD4 and related domains. It belongs to the START domain family, and in turn to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD4 plays an important role in steroidogenesis, trafficking cholesterol into mitochondria. It specifically binds cholesterol, and demonstrates limited binding to another sterol, 7alpha-hydroxycholesterol. STARD4 is ubiquitously expressed, with highest levels in liver and kidney.
Statistics
?
PSSM-Id: 176911
View PSSM: cd08902
Aligned: 3 rows
Threshold Bit Score: 442.471
Threshold Setting Gi: 148229683
Created: 19-May-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative lipid
Conserved site includes 44 residues -Click on image for an interactive view with Cn3D
Feature 1:putative lipid binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                   ##      #            # #          #   #     #  ## ## 
1JSS_A        21 SDVASISTKLQNTLIQYHSIEEDEWRVAKKAkDVTVWRKPSEEFnGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMT 100 house mouse
NP_001073210   5 PDPAPLATRLQNTLLRYHSIADSEWRIARKTkDAVVWRKPSEEFsGYLYKAQGVVEDVTNRIVDHIRPGPYRLDWDSLMT 84  chicken
NP_001091197   4 LDIPSKTTKLQNTLIQYHCTLEEEWRVAKKSsDVTAWRKPSEEFgGCLYKIEGIVEDDYNRIVDYIRPGPYRLQWDSLMT 83  African clawed ...
Feature 1                        # ####    #  # # #              #              # #### #         
1JSS_A       101 SLDVLEHFEeNCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVRGYNHPCGWFCVPLkdsP 180 house mouse
NP_001073210  85 TMDIVETFEeNCCVMRYTTAGQLWNIIAPREFVDFSYTTSYEDGLLSCGVSLNYGEVRPNFVRGFNHPCGWFCVPLkdyP 164 chicken
NP_001091197  84 SMDIIKEFNkECCVMRYTTAGQLLNIISPREFVDFSYTTQYEDGLLTCGVGIEYEDARPNCVRGFNHPCGWFCVPLqnnP 163 African clawed ...
Feature 1            # # # # # #      # ### ###  ##  #     
1JSS_A       181 SQSLLTGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKGLR 222 house mouse
NP_001073210 165 SHSLLTGYIQTELRGMLPQSAVDTAMASTLTNFYSDLKKALK 206 chicken
NP_001091197 164 QHSLLTGYIQTDLRGMLLQKTVDFAMASSLVNFYSDLKKALK 205 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap