Conserved Protein Domain Family
SRPBCC_PITPNC1_like

?
cd08890: SRPBCC_PITPNC1_like 
Lipid-binding SRPBCC domain of mammalian PITPNC1,and related proteins (Class IIB PITPs)
This subgroup includes the N-terminal SRPBCC (START/RHO_alpha_C /PITP /Bet_v1/CoxG/CalC) domain of mammalian Class IIB phosphatidylinositol transfer protein (PITP), PITPNC1/RdgBbeta, and related proteins. These are metazoan proteins belonging to the PITP family of lipid transfer proteins, and to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. Mammalian PITPNC1 contains an amino-terminal SRPBCC PITP-like domain and a short carboxyl-terminal domain. It is a cytoplasmic protein, and is ubiquitously expressed. It can transfer phosphatidylinositol (PtdIns) in vitro with a similar ability to other PITPs.
Statistics
?
PSSM-Id: 176899
View PSSM: cd08890
Aligned: 8 rows
Threshold Bit Score: 455.417
Threshold Setting Gi: 62484257
Created: 29-Jul-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:putative lipid binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           ##  #   #  #      #                  # # # #  # #  #   #  ## 
Q9UKF7         2 LLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDphHGNGQFTEKRVYLNSKLPSWARAVVPkIFY 81  human
NP_001039199   2 LLKEYRICMPLTVEEYRIGQLYMISKHSHEQSERGEGVEVVQNEPYEDpvHGQGQLTEKRVYLNSKLPSWARAVVPkIFY 81  western clawed ...
XP_002128874   2 LLKEYRICMPLSVEEYQRGQLYMINRHSNEQSESGEGVEVIKNEPVYTeeNGDGQFTEKRIHLNNRLPNWARSFVP-SIY 80  Ciona intestinalis
NP_611248      3 LIKEYRVCMPLTVEEYKIGQLYMIARHSLEQSEEGEGVEVVENKPCEDpvHGKGQYTEKHIHLSSRLPYWIQAICPrVFY 82  fruit fly
XP_002117968   2 IVKEYRICMPMTVEEYRIGQLYMIARFSEEQSCKGSGVQVVVNEPCYDekHGKGQYTEKKIYLNGRLPAWLGSILPnIFY 81  Trichoplax adha...
XP_001639980   2 MLKEYRICMPLSVDEYRVGQLYMINRHSHDQSETGEGVHVVKNEACEDkeHGNGQFTEKRVYLSSRLPSWVRSYIPkIFY 81  starlet sea ane...
XP_002194332   2 LMKEYRICMPLTVEEYRIGQLYMISKHSHEQSDRGEGVEVVQNEPYEDpnHGNGQLTEKRVYLNSKLPSWARAVVPkIFY 81  Taeniopygia gut...
CAG06130      29 ILQMFAQLSGTGGSEYRIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDpdHGQGQFTEKRVYLNSKLPSWARAVVPkIFY 108 Tetraodon nigro...
Feature 1        # # # #    # # #  ##     # #                                                    
Q9UKF7        82 VTEKAWNYYPYTITEYtCSFLPKFSIHIETKYEDNKG-------SNDTIFDNEAKDVEREVCFIDIACDEIPERYYKESE 154 human
NP_001039199  82 VTEKAWNYYPYTITEYtCSFLPKFSIHIETKYEDNKG-------SNDNIFESEAKDAEREICFVDIACDEIPERYYKESE 154 western clawed ...
XP_002128874  81 VTEKAWNYYPYTITEYtCPWLPRLHIHIETRYENNNGhnndfscAKVSKEIDPKEFTKREVIHLDLAYDKVPDKHYKADE 160 Ciona intestinalis
NP_611248     83 VIEKSWNYYPYTLTEYtCSFIPKLNVLIKTKYEDNNGs------TENCLDLTEDELKVRTVDHLDIAFDEVSAKHYKKEE 156 fruit fly
XP_002117968  82 ITEKAWNYYPFTITEYtCSFIPKFHVKIETTYKDDNGk------DENALDLPEEILSKREVFHLDIAYDQLPDKYYVKEE 155 Trichoplax adha...
XP_001639980  82 IVEKAWNFYPFTITGI-CSFLPRFSIKIETRYLNDKGc------TENCFNLSPEELESREVIPVDIAFDELPEKYYVAEE 154 starlet sea ane...
XP_002194332  82 VTEKAWNYYPYTITEYtCSFLPKFSIHIETKYEDNKG-------SNDSIFDKEAKDLEREICFIDIASDEIPERYYKESE 154 Taeniopygia gut...
CAG06130     109 VTEKAWNYYPYTVTEYtCSFLPKFSIHIETKYEDNKG-------SNDNIFDNELKEQEREVCFVDIAYDEIPERYYKESE 181 Tetraodon nigro...
Feature 1                                      #     # #         #   ## ###  #                   
Q9UKF7       155 DPKHFKSEKTGRGQLREGWRDSHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDDV 234 human
NP_001039199 155 DPKNFVSEKTGRGQLKEGWREAQEPIMCSYKLVAVKFEVWGLQSRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDEV 234 western clawed ...
XP_002128874 161 DCTKFKSIKTGRGPLKPNWRESHSPIMCSYKLVQVKFEVWGMQTKVESYIHKVVRDVLLLAHRQAFAWIDTWYDMTFDNI 240 Ciona intestinalis
NP_611248    157 DPKFFKSEKTNRGPLIEGWRETDKPIMCSYKVVHASFEVWGLQTKVEDFIQRGIREILLLGHRQAFAWVDEWHGMTLEDV 236 fruit fly
XP_002117968 156 DCRYFHSKKTNRGPLAENWKESCKPIMCSYKVVSVSFSMWGFQQRVESFTHKNIRDVLVHGHRQAFAWIDEWINMTVDDV 235 Trichoplax adha...
XP_001639980 155 DCRTFKSAVTGRGPLEPGWRDTSDPIMCSYKLVNVSFDVWGLSQRVEAYVHKVVQDILLVGHRQAFAWIDLWYEMDINDV 234 starlet sea ane...
XP_002194332 155 DPKYFKSQKTGRGQLKEGWRETHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDDV 234 Taeniopygia gut...
CAG06130     182 DLRYFKSQKTSRGILQEGWRDTQDPIMCSYKLVTVKFEVWGLQTRVEQFVHKVIRDVLLLGHRQAFAWVDEWIDMTMDEV 261 Tetraodon nigro...
Feature 1                        
Q9UKF7       235 REFERATQEATNKKIG 250 human
NP_001039199 235 REYERTTQEATNRKIG 250 western clawed frog
XP_002128874 241 RRYESEIQEKTNAKVK 256 Ciona intestinalis
NP_611248    237 RAYERQKQAETNEKIH 252 fruit fly
XP_002117968 236 RDFERKAQDRTNEKLM 251 Trichoplax adhaerens
XP_001639980 235 REYEKTMQEKTNNKVA 250 starlet sea anemone
XP_002194332 235 REYEKNMHEKTNIKVC 250 Taeniopygia guttata
CAG06130     262 REFERNIQEATNQKIG 277 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap