Conserved Protein Domain Family
SRPBCC_PITPNM1-2_like

?
cd08889: SRPBCC_PITPNM1-2_like 
Lipid-binding SRPBCC domain of mammalian PITPNM1-2 and related proteins (Class IIA PITPs)
This subgroup includes an N-terminal SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of mammalian Class II phosphatidylinositol transfer protein (PITPs), PITPNM1/PITPalphaI/Nir2 (PYK2 N-terminal domain-interacting receptor2) and PITPNM2/PITPalphaII/Nir3), Drosophila RdgB, and related proteins. These are membrane associated multidomain proteins belonging to the PITP family of lipid transfer proteins, and to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. Ablation of the mouse gene encoding PITPNM1 results in early embryonic death. PITPNM1 is localized chiefly to the Golgi apparatus, and under certain conditions translocates to the lipid droplets. Targeting to the latter is dependent on a specific threonine residue within the SRPBCC domain. PITPNM1 plays a part in Golgi-mediated transport. It regulates diacylglycerol (DAG) production at the trans-Golgi network (TGN) via the CDP-choline pathway. Drosophila RdgB, the founding member of the PITP family, is implicated in the visual and olfactory transduction. RdgB is required for maintenance of ultra structure in photoreceptors and for sensory transduction. The mouse PITPNM1 gene rescues the phenotype of Drosophila rdgB mutant flies. In addition to the SRPBCC domain, PITPNM1 and -2 contain a Rho-inhibitory domain (Rid), six hydrophobic stretches, a DDHD calcium binding region, and a C-terminal tyrosine kinase Pyk2-binding / HAD-like phosphohydrolase domain. PITPNM1 has a role in regulating cell morphogenesis through its Rho inhibitory domain (Rid). This SRPBCC_PITPNM1-2_like domain model includes the first 52 residues of the 224 residues Rid (Rho-inhibitory domain).
Statistics
?
PSSM-Id: 176898
View PSSM: cd08889
Aligned: 11 rows
Threshold Bit Score: 522.782
Threshold Setting Gi: 238659343
Created: 29-Jul-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:putative lipid binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                             ##  #   #  #       #                  # # # #  # #  #   #   
AAK01444        1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESsGEGSGVEILANRPYTdgpggSGQYTHKVYHVGSHIPGWFRALLPKA 80   human
NP_001135661    1 MLIKEYRIPLPMTVEEYRIAQLYMIQKKSREETcGEGSGVEILENRPYTdgpggTGQYTHKVYHIGMHIPSWFRSILPKA 80   western clawe...
NP_511149       1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREEShGEGSGVEIIINEPYKdgpggNGQYTKKIYHVGNHLPGWIKSLLPKS 80   fruit fly
CAG08452        1 MLIKEYRIPMPMSVEEYRIAQLYMIQKKSREEScGEGSGVEILENKPYKdgpggSGQYTHKVYHIGMHIPSWFRSILPKA 80   Tetraodon nig...
XP_001633950    1 MLIKEYRIPLPMSVDEYRIAQLYMIQKKSRLESvGEGSGVEILENRPYMnkdggSGQFTKKIYHIGSHLPGWLKAILPKS 80   starlet sea a...
XP_002120698    1 MLIKEYKIPMPLSVQEYRIAQLYMIQKKSREESqGTESGVEIIQNKPYSdgpggDGQYTQKIYHISKHIPGWLVAILPKD 80   Ciona intesti...
XP_002115721    1 MLIKEYRIPLPLSVEEYRTAQLYMIQKKSRLESkDKSDGVEIIENRPYE-----NGQYTKKIYHIGSHLPAWLKAILPKS 75   Trichoplax ad...
NP_497726       1 MLIKEYRILLPMTVQEYRIAQLYMIQKKSRLDShGQDSGVEIISNKPYTdgpggSGQYTFKIYHIGSRIPAWIRTVLPTN 80   nematode
CAZ30379        1 MLLKEYRICMPLTVAEYRIAQLYMIQKKSREEStGRGSGVEILKNEPYEngpggKGQYTFKIYHVGSHLPTWLRNILPSS 80   Schistosoma m...
AAK01445        1 MIIKEYRIPLPMTVEEYRIAQLYMIQKKSRNETyGEGSGVEILENRPYTdgpggSGQYTHKVYHVGMHIPSWFRSILPKA 80   human
XP_002436111    1 MLLKEYRIPLPLSVDEYRVAQLYMIAKKSREESkGAGSGVEILVNEPYEdgpggCGQYTHKIYHVGSHLPGWFKALLPKS 80   black-legged ...
Feature 1         ## # # # #    # # #  ##     # #                                                 
AAK01444       81 ALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAvapgEYKAEEDPR 160  human
NP_001135661   81 ALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKSDYGDLANVFNLSPAEKRQTTLDPIDIVKDPipphEYKPEEDPK 160  western clawe...
NP_511149      81 ALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQlwggDYVKEEDPK 160  fruit fly
CAG08452       81 ALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKPDTGDQVDVFNLSAADKRQRTIDPIDIVTDPipphEYKAEEDTR 160  Tetraodon nig...
XP_001633950   81 ALRVEEEAWNAYPYTKMRTTCPFVEKFFVDVETHYLPDAGQTANVFNLTPAELNSREVDFIDPIAEVvasgDYLAEEDPL 160  starlet sea a...
XP_002120698   81 ALIVEEEAWNAYPYTRTRYTCPFIEKFSIDIETRYFDDTGEQENVFDLPNSGLRSRSVDEIDIVNEQs--sDYKKEEDPR 158  Ciona intesti...
XP_002115721   76 ALNVEEEAWNAYPYTRTRYKCPFVEKLILDIETIYTDDHGTQDNVFKLSETELRARIIDHVNVVCDKvpnsEYKAEEDPK 155  Trichoplax ad...
NP_497726      81 ALEAHEESWNAYPVTKTRYSTPMMDRFSLEVETLYFDDHGQQENVFNLNEKDKSTRIIDYMDFVKDPisshDYCAEEDPK 160  nematode
CAZ30379       81 ALRVEEEAWNAYPYTRTIYKVPFVEKLVLDVETYFFDDAGEQDDVFNLSPDERKARIIDFIDIVKDSitgsDYKPEEDPS 160  Schistosoma m...
AAK01445       81 ALRVVEESWNAYPYTRTRFTCPFVEKFSIDIETFYKTDAGENPDVFNLSPVEKNQLTIDFIDIVKDPvphnEYKTEEDPK 160  human
XP_002436111   81 ALTVEEEAWNAYPYTKTRYTCPFIERFYLEIETKYFGDAGEQENVFELAGPELRNRQVDVIDVVRDQlfgaDYVREEDPR 160  black-legged ...
Feature 1                                                                     #     # #          #
AAK01444      161 LYHSVKTGRGPLSDDWArtaa------------------------------qtgPLMCAYKLCKVEFRYWG-MQAKIEQF 209  human
NP_001135661  161 LYKSIKTKRGPLSDDWIedhrn---------------------------nigkyPIMCAYKLCKVEFRYWG-MQSKIERF 212  western clawe...
NP_511149     161 HFVSDKTGRGPLAEDWLeeywrevkg-------------------kkqptprnmSLMTAYKICRVEFRYWG-MQTKLEKF 220  fruit fly
CAG08452      161 LYKSVKTQRGPLRDDWIeeykn---------------------------npgktPIMCAYKLCKVEFRYWG-MQTKIERF 212  Tetraodon nig...
XP_001633950  161 IYQSKKTGRGPMKADWLeayqt---------------------------dnpptPVMCAYKLIKVEFRYWG-MQSKIEHF 212  starlet sea a...
XP_002120698  159 HYVSKATGRGPLSDDWItnakkc-------------------------ppekrgNFMCAYKQCKVEFKYWG-MQSKIEKF 212  Ciona intesti...
XP_002115721  156 LYQSTKTGRGPLKEDWLqsyepqy-----------------------agkacssSVMCAYKLCRVEFRYWG-MQTKIEWF 211  Trichoplax ad...
NP_497726     161 LYRSETTNRGPLNDDWVaehl-----------------------------kkglPIMCAYKLCKVEFRYWG-MQTRAERW 210  nematode
CAZ30379      161 IYVSEATGRGPLSPNWReefidaqqvthetyekpptrtydnspatveclkplhkRIMCAYKLCRVEFRYWG-TQTRVEQF 239  Schistosoma m...
AAK01445      161 LFQSTKTQRGPLSENWIeeyk-----------------------------kqvfPIMCAYKLCKVEFRYWG-MQSKIERF 210  human
XP_002436111  161 LFVSPKTGRGPLDEDWIqgfldhrlqg------------------mpppppgdgTIMCAYKLCRVEAARWPqSELLDSHV 222  black-legged ...
Feature 1                ###  #                                   
AAK01444      210 IHDVGlRRVMLRAHRQAWCWQDEWTELSMADIRALEEETARMLAQRMA 257  human
NP_001135661  213 IHDVGlRKVMVRAHRQAWCWQDEWYGLTIEDIRQLEKETQLMLAQKMA 260  western clawed frog
NP_511149     221 IHDVAlRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMG 268  fruit fly
CAG08452      213 IHDVGlRKVMVRAHRQAWCWQDEWYGLTMEDIRQLELETQLALAMKMA 260  Tetraodon nigroviridis
XP_001633950  213 IHSGL-RRPMLMGHRQAWVWQDEWYGLTMGDIRRLEEETKAILSQTMG 259  starlet sea anemone
XP_002120698  213 IHDTGlRKVMLRAHKQAWCWQDEWYGLTIDDIRKLEKETQLALQLKFG 260  Ciona intestinalis
XP_002115721  212 IHNIAiRKTLVRAHRQAWCWQDEWFGLTIQDIRKLEEETKLLLSSKLI 259  Trichoplax adhaerens
NP_497726     211 IHDLAlRNTMMRAHRQAWAWQDEWTGLTMNDIRKLEAEAALHLSKVMS 258  nematode
CAZ30379      240 IHDTAlRKTMLRAHRQVWAWQDEWYGLTIEEIRRLEEETAQALASKMA 287  Schistosoma mansoni
AAK01445      211 IHDTGlRRVMVRAHRQAWCWQDEWYGLSMENIRELEKEAQLMLSRKMA 258  human
XP_002436111  223 TVAVAlRKTMLRAHRQAWAWQDEWVGLTMEDIRQIERETQEALARKMA 270  black-legged tick

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap