Conserved Protein Domain Family
START_1

?
cd08876: START_1 
Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family
Functionally uncharacterized subgroup of the START domain family. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. For some mammalian members of the START family (STARDs), it is known which lipids bind in this pocket; these include cholesterol (STARD1, -3, -4, and -5), 25-hydroxycholesterol (STARD5), phosphatidylcholine (STARD2, -7, and -10), phosphatidylethanolamine (STARD10) and ceramides (STARD11). Mammalian STARDs participate in the control of various cellular processes, including lipid trafficking between intracellular compartments, lipid metabolism, and modulation of signaling events. Mutation or altered expression of STARDs is linked to diseases such as cancer, genetic disorders, and autoimmune disease.
Statistics
?
PSSM-Id: 176885
View PSSM: cd08876
Aligned: 32 rows
Threshold Bit Score: 183.627
Threshold Setting Gi: 71280857
Created: 31-Jul-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative lipid
Feature 1:putative lipid binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                          ##         #            # #           #   #   
Q9I3D8        10 LAAAVFGVAGNALAED---------------WKLAKDe---dGVKVYLSSVQGSkyKAYRGVTDIKA-DVATIEALQEDV 70  Pseudomonas aer...
ZP_01102508   13 ALLFSITWAGSALSAE---------------WETQFDe---gGVRVDTRDVDESayQAFRAQAVVAA-SPEAVLARLRDT 73  Congregibacter ...
EDL54480       8 ILFSTILLTGSLSAEEns------------yWQFDSDn---dGITIYTREHTDGl-VEIRAQMFTPT-TYSAFLTLLEDS 70  Vibrio shilonii...
NP_936609      9 SLCLFLFNPATLASPQq-------------gWIFDSSd---nGITIHYREHTDGl-VEIRAQMFFPT-SYAAFLKLLEDT 70  Vibrio vulnific...
ZP_01611564   16 SLLIILLSFNTYSEPR---------------WQLYKNe---qGVSIEYQEFSDDt-FIVKGQLNIEDvTANDFLDLLSDT 76  Alteromonadales...
ZP_01691060    6 AVLLVFTNHFAGMPSYpfhgnns--attfkaWKLIKNk---eGISVYARKYKNTnhRELKAIAVFKA-SLSSLVAIIKDD 79  Microscilla mar...
YP_001530244  15 SICLVVCLPFDALAQE---------------WERVLEq---dGIVVYERQRPDApmRDFRAEMVLDS-SPASVLALFDDT 75  Desulfococcus o...
ZP_03560970   14 WLLISSLYSPVILAQIsv-----------qdWEQKQVs---qHILVSSSTVNNV--YKVNAKMYVHA-TPDEFFALLEHT 76  Glaciecola sp. ...
ZP_01074216   20 CLLFIGLASTSSQADQgsiqadrahligespWQRWKTs---dSLSVYYRDYKETglIEIKAQARLQS-SLSGFLLFLQDY 95  Marinomonas sp....
ZP_05062034    6 IAGGALLASCAASAEArq-----------ydWTLEDRgetreAVTRYSSDVDGQaiDAFRGVAEVPY-SMPAVLAAILDT 73  gamma proteobac...
Feature 1          #  ##   ##                  # #### #  # # #                #                  
Q9I3D8        71 KGSCKWIH--ACAEMKLLKQEGa-dAWTYSKIDMPWpVTGRDVVIHVTTEKta-dgTVIRHLKADPTy---iPEEkGQIR 143 Pseudomonas aer...
ZP_01102508   74 ESYPDWFP--NTIEARRLEAQGd-sWSHYVRTDAPWpVKDRDAIYTQRLERdg--eNLRIIVGVSPDa---lPESkDAVR 145 Congregibacter ...
EDL54480      71 ENVPNWID--NASHSRVLRQISineNIVYTQFKAPWpARDRDMVTYSKYWVdd--yGFTIEINDAPEss--lPIQkGYIR 144 Vibrio shilonii...
NP_936609     71 DNVPNWID--NVAHSHVVQQLSpreNIVYTQFAAPWpAQNRDMLTYSKYSLde--aGFTLQISDAPEta--fPRDpDYIR 144 Vibrio vulnific...
ZP_01611564   77 RIASSWLE--NTSKVRVIKALSpseNLVYSYIDSPWpVANRDAVTYSCYSRls-pqQTKLSIESRPEe---lPLTkRVVR 150 Alteromonadales...
ZP_01691060   80 ASVPQWIN--RMKLFQNIHTVSnqqWYTYAEISLPFpYYNRDLISLNTLEQnsdnhIVVIDIESKPNy---lPKKrKKVR 154 Microscilla mar...
YP_001530244  76 EQTPQWFA--HCRRLERIAEITpdeHFLYNITEFPWpLKDRDAVLHSIRTFekenkRFVIDYQSDEKyaypsAEP-GLVR 152 Desulfococcus o...
ZP_03560970   77 QKDCSWIA--NCKRVEVLNQSLsqyRFVHTVFNSPWpVADREMYTRSFHQFdqshqHLSILIEDISSd---yPTHpKRVM 151 Glaciecola sp. ...
ZP_01074216   96 PLIPNWLE--NAKSADLIEQTNdteNLFVTSFYGIWpVSEREMVIRSRYWQns-dlSVELQVEDAAHe---vPNPdHVIR 169 Marinomonas sp....
ZP_05062034   74 DGFRDWIFgfKTVEKRPIADEP---TSLYLAFHATWpAKDRDVVVVGDMDIdvfsgVVQIHSRHAPEa----PERsGHVR 146 gamma proteobac...
Feature 1        # #### #           # # # # # #      # ### ###  ##  #     
Q9I3D8       144 VPKLVGEWKLQPKgQGVTEVTYQVETEPGGSIPSWLANSFVVDAPLNTLKGLRSAAE 200 Pseudomonas aeruginosa
ZP_01102508  146 IQAAAGRWELVAS-DGGTSIHWEFHAEPGGNLPGSLVNARVIGTPKGALQALQAHFA 201 Congregibacter litoralis KT71
EDL54480     145 ITSVDASWNLQKLtNGTTLIEYKAYADPGGILPDWLMNKLSTQSARATFNNLRNQLP 201 Vibrio shilonii AK1
NP_936609    145 ITQVKALWVLNKLtNDTTHIEYTAFANPGGALPDWLVNKLAKESARATFEGLREQLP 201 Vibrio vulnificus YJ016
ZP_01611564  151 IKTLNAHWLLTQK-GEDLNIEYQVYALPGGNIPTWLYNKVGLKSTFKTLVNLRTMLE 206 Alteromonadales bacterium TW-7
ZP_01691060  155 MKNAEGQWRFKPLgNGKILVSYQFYAEPNLGLPAWIINPLATKGVWNTLKKFREMAK 211 Microscilla marina ATCC 23134
YP_001530244 153 VNHVEGQWTITPLgPHRTLVTSRVYADMGTLLPGWTLNPFFREATHLTFVNLRQTAQ 209 Desulfococcus oleovorans Hxd3
ZP_03560970  152 MNNVTAQWSMSYShDGWYELNYLASAEPGGLIPTWLSKTLLKNATAETFAQLRERLH 208 Glaciecola sp. HTCC2999
ZP_01074216  170 IKIEKAHWILTPLaQGKIKIKYIIVADPMGKVPLWIANKVALRSMWNTLNALETQLA 226 Marinomonas sp. MED121
ZP_05062034  147 IEELDNRWILTPLdNGWTRIDFRTFVDIGGWVPGWLANMVATDTPYQTLEGLRKRLD 203 gamma proteobacterium HTCC5015

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap