Conserved Protein Domain Family
DAP_dppA_3

?
cd08770: DAP_dppA_3 
Peptidase M55, D-aminopeptidase dipeptide-binding protein family
M55 Peptidase, D-Aminopeptidase dipeptide-binding protein (dppA; DAP dppA; EC 3.4.11.-) domain: Peptide transport systems are found in many bacterial species and generally function to accumulate intact peptides in the cell, where they are hydrolyzed. The dipeptide-binding protein (dppA) of Bacillus subtilis belongs to the dipeptide ABC transport (dpp) operon expressed early during sporulation. It is a binuclear zinc-dependent, D-specific aminopeptidase. The biologically active enzyme is a homodecamer with active sites buried in its channel. These self-compartmentalizing proteases are characterized by a SXDXEG motif. D-Ala-D-Ala and D-Ala-Gly-Gly are the preferred substrates. Bacillus subtilis dppA is thought to function as an adaptation to nutrient deficiency; hydrolysis of its substrate releases D-Ala which can be used subsequently as metabolic fuel. This family also contains a number of uncharacterized putative peptidases.
Statistics
?
PSSM-Id: 176452
View PSSM: cd08770
Aligned: 12 rows
Threshold Bit Score: 320.043
Threshold Setting Gi: 90331139
Created: 1-Apr-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:putative metal binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               # #                                                 #                    
Q2JK39         1 MKVYISADIEGIAGISHWDEATIGQpgYEAFREQMTRAVIAACEGSLAAGATQITVKDAHDSGRNLIPERLPEPVQLIRG 80  Synechococcus s...
ZP_02087641    1 MKVYISVDIEGTANAVGWDSTAPGGldYERNRLEMTKEAVAAARGAHAAGADEIVIKDAHGHGNNILPEYMPEYVELIRS 80  Clostridium bol...
ZP_02693107    1 MKIYISADIEGISSISTWQESDMKA--PSEACARMTREVCAACEAAIEMGATEVLVKDAHGYGKNICHEDLPTQVKLMSG 78  Epulopiscium sp...
YP_064599      2 KKIYISADIEGICGVTDWGETELGSatHEEFRRQMTCEVAAACEGAIEAGVEEILVQDAHDSARNILAADLPPKVQLIRG 81  Desulfotalea ps...
Q8GPN3         1 MKVYISADLEGVAGSTTWIETEKNTpdYAPFQKQMTKEVEAAIEGAIAGGATEIVLKDAHDSARNIDISNLPVNVKIIRG 80  Brevibacillus b...
ZP_03761355    1 MKVYISADIEGTAGIASWSATNLGDpeHRAAAQEMTLEAVAACQGALDAGATELYVKDAHDSGRNMDLSLFPREAKVIFD 80  Clostridium asp...
ZP_02089352    1 MKLFISADIEGCAGVALAYETHKNEaaYGEFAKQMTKEVVAACEAAHEAGADEIVVKDGHGDATNIDPLCMPDYVTLIRG 80  Clostridium bol...
YP_001087895   1 MKLYLSADIEGTCGIVNWDETKLECefSQHYRTQMSKEITAACDGATQSGVHEILVKDAHDSGRNINPNILPENVKILRG 80  Clostridium dif...
Q988N6         1 MKVFISADIEGTAGITNWDEAKKGNpdYAEFREYMTDELVAACEGARAAGATEVVVKDAHSTARNLILSKLPDYVRIVRG 80  Mesorhizobium loti
ADG31349       1 MKIFISADIEGIAGISHWDEASLHKpdFSIFQEQMTAEVTAACEGALEAGATEIWVKDGHGTGRNLLASRLPPPTRLIRG 80  Thiobacillus in...
EFH00040       1 MRVYISADLEGITGVSKWEETHKGGhyYDLYREQMTREVVAACEGAIEAGAEYIMVKDAHEDGKNLIHSMLPRGVKVISG 80  Clostridium len...
EAS46395       4 KRLYISADIEGVAGVVSSEHTTPAGfeDQQAREWYTAEVLAVCEAACEKGIEEIVVSDSHGNGQSLLIDKLPDNVQVVRS 83  gamma proteobac...
Feature 1                                   #                              #                     
Q2JK39        81 wSGHPYCMvqELDRS---YDALLLiGYHARAGsaanPLAHTYtte-vsQIRLNGQaIAEFHLVSLTAAyeGVPVvFVAGD 156 Synechococcus s...
ZP_02087641   81 yTYAPDVMveGIDES---FDAAFYvGYHSAAGcegnNLAHTIshskvhSIKVNGEiASEFMIYSYMAAyrNVPSvLLTGD 157 Clostridium bol...
ZP_02693107   79 wANHPYNMveGIDES---YEGVVFlGYHSAAStpdsPLSHTLdtr-laKVTLNGEiASEFLIYHTLTNslNVPTlLVTGD 154 Epulopiscium sp...
YP_064599     82 wAGHPYCMlqSLDSS---YDAVLFiGYHCAGGrvgnPLAHTMtndkayWLKLNGEfVSEFYLNSLIACreNVPVlFLSGD 158 Desulfotalea ps...
Q8GPN3        81 wTGDPMCMvaGLDES---FDRAIFiGYHSKGGshrnPLAHTLvv--naDVKINGEyASEFLINAYAAAlhGVPVaFVSGD 155 Brevibacillus b...
ZP_03761355   81 wTLTPDSMvaGLDGS---FDALMFvGYHSPAGlpgsPLSHTMnrg-nnYVKINGElASEFLLHAYVGAarGVPSvMVSGD 156 Clostridium asp...
ZP_02089352   81 kSGHPYNMmsGLDDS---FDGVMYiGYHAPAGnpgfAISHTStgn-slYIRLNGScMSEFMLNSYTAAshKVPVlFLSGD 156 Clostridium bol...
YP_001087895  81 wTKDPLVMmaGIDES---FDACIFtGYHSGATcngnPLSHTMdid-ydYFKINDEiASEFTINAYIAAyyNVPVaFLSGD 156 Clostridium dif...
Q988N6        81 wSGHPDMMmfGIDIS---FAAALYtGYHNKAGtdtnPLAHTLtgt-vsRLLINGEvASEYTLNALCAAryRVPSaFLSGD 156 Mesorhizobium loti
ADG31349      81 wSGHPYQMlqELDET---FSAVVMiGYHAAAGaagnPLSHALtkg-laELRINGRhASEFLLNAYTAAllKVPVaLVSGD 156 Thiobacillus in...
EFH00040      81 wSNHPYCMveGLDES---FDAVIFiGYHSGASsngsPLAHTLlpdvikNVTINGEdADEFLIHAYAAYmlGVPIvAVSGD 157 Clostridium len...
EAS46395      84 -WPRPLCM--MAGVElgdYVGAMLiGYHSGASdmrgVLAHTLhggaisEVRLNGKvASETVISAATAAhfGVPLiMVSGC 160 gamma proteobac...
Feature 1                                                                                        
Q2JK39       157 aEVCAEAKAY-----------DAQIETVVtHKGMGQSVIAPhpQQVLRAIRQGVEGSLRrlpayrpRPLPDHf------- 218 Synechococcus s...
ZP_02087641  158 rSLCQTGKKY-----------HPCLVTVPvKDDIGGRNRGIsgELACKQIEKAAKHALE-------QDLAEArivl-pgh 218 Clostridium bol...
ZP_02693107  155 gGIVREVSEL-----------DPNIEAVAvKEGFAGAMISNhpAMACKEIKEALKRGISk------RDSIEMpmi---de 214 Epulopiscium sp...
YP_064599    159 aEVCAEANQL-----------SSSIATLAsKEGMGASTINRhpSEICAETRRLVAEVLKrga--pgSLTMPQt------- 218 Desulfotalea ps...
Q8GPN3       156 vGLTEEIKAV-----------NENIVTLPiKEGIGGATVSIspKLAISETKRLVEEAMKv-----dRDSIKIelp---kq 216 Brevibacillus b...
ZP_03761355  157 kLLCGHAQEF-----------VPGIQTAPvKEGLGRATVNLtpQLACERIREAAREGLLhr---nrCHLAVPet------ 216 Clostridium asp...
ZP_02089352  157 sTICGLAREM-----------VPDITTAVtKTGLGASTYCKapGQVEESIRQGVKKALAgn---lsRCSVELpe-----t 217 Clostridium bol...
YP_001087895 157 eMLCESAKKL-----------NPNIVTVPvSKGIGNGSISIhpNLALKKIEKGVKKALSgd---lsRHLIKLpd-----k 217 Clostridium dif...
Q988N6       157 aGMCADAKVL-----------VPAIGTVAtSEGFGPATSSLtpGAAVKAIRDGVEAALS-------RDLSVClprl-ads 217 Mesorhizobium loti
ADG31349     157 qALCDDVVAV-----------NPSIQTVPvKAGVGDSTVSLhpGEAVRRIREQIAHALRtd---ltSCGLDLpe-----h 217 Thiobacillus in...
EFH00040     158 gDLMRSVRSF-----------NPQIKTIAvQEGFGGAVVSIhpDLAIERIRKGVKKGLEal----eEYTFEKpe-----e 217 Clostridium len...
EAS46395     161 dAYKSKKAPVqpatkftyvvgDKASVAAV-KKGVAIGEAVGygASFARDLGNTPPNICHp------SYLSKQakamarge 233 gamma proteobac...
Feature 1                                                                   
Q2JK39       219 -QLEVDYkDPARAYRKSFYPGCRWIAd-----sTVRLEVse-------wfEVLRALEFI 264 Synechococcus sp. JA-2-3B'a(2-13)
ZP_02087641  219 fDVELCFkDHTLAKSGSYYPGATQKDp-----yTITFQSdd-------wyDVGRFLIFT 265 Clostridium bolteae ATCC BAA-613
ZP_02693107  215 fTLEVTFkEHKEAYKYSFFPHATQVNs-----hTIKIQSen-------yqDILTFLLFI 261 Epulopiscium sp. 'N.t. morphotype B'
YP_064599    219 fTLEICYsGHALAYRNSFYPGATLVDg-----nRLLFATqd-------yfEVLRFIHFV 265 Desulfotalea psychrophila LSv54
Q8GPN3       217 fNVEIIYrDHTRAYRNSFYPGAKFKPh-----nTVEYETdn-------yfDVLRILQFL 263 Brevibacillus borstelensis
ZP_03761355  217 lTMEIGFkDHFKALRASHYPGATLVDp-----yTVTYTAat-------vdEMMTARMFI 263 Clostridium asparagiforme DSM 15981
ZP_02089352  218 fTYEVTYkDWKKAYQMSFYPGMRAVDt-----fTNRLETar-------wmDVVTAHCFV 264 Clostridium bolteae ATCC BAA-613
YP_001087895 218 fKIEIKFrEHYKAFKASFYPNMKKIDs-----qTVLFETed-------yyEFLRMLLFI 264 Clostridium difficile 630
Q988N6       218 fELVVEYtTPVEAYGASWYPGVEHVAa-----rTLRFKAad-------ffDIQRAVRFI 264 Mesorhizobium loti
ADG31349     218 fRVELRYkEHTDAYRNAFYPGAKLKDa-----cIIVFETpd-------yfEVLRFLLFT 264 Thiobacillus intermedius K12
EFH00040     218 yELIIEFkKHADAYKFSFYPNVEQIGe-----yTIRYVSnn-------ymHLLVLLLFI 264 Clostridium lentocellum DSM 5427
EAS46395     234 pRLSVKVlGEKEMDALGMHSLLSVGRgsvqpsqLIVMEYkggkkgdapyaIVGKGITFD 292 gamma proteobacterium HTCC2207

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap