Conserved Protein Domain Family
DAP_dppA_2

?
cd08769: DAP_dppA_2 
Peptidase M55, D-aminopeptidase dipeptide-binding protein family
M55 Peptidase, D-Aminopeptidase dipeptide-binding protein (dppA; DAP dppA; EC 3.4.11.-) domain: Peptide transport systems are found in many bacterial species and generally function to accumulate intact peptides in the cell, where they are hydrolyzed. The dipeptide-binding protein (dppA) of Bacillus subtilis belongs to the dipeptide ABC transport (dpp) operon expressed early during sporulation. It is a binuclear zinc-dependent, D-specific aminopeptidase. The biologically active enzyme is a homodecamer with active sites buried in its channel. These self-compartmentalizing proteases are characterized by a SXDXEG motif. D-Ala-D-Ala and D-Ala-Gly-Gly are the preferred substrates. Bacillus subtilis dppA is thought to function as an adaptation to nutrient deficiency; hydrolysis of its substrate releases D-Ala which can be used subsequently as metabolic fuel. This family also contains a number of uncharacterized putative peptidases.
Statistics
?
PSSM-Id: 176451
View PSSM: cd08769
Aligned: 22 rows
Threshold Bit Score: 338.061
Threshold Setting Gi: 206738342
Created: 31-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:putative metal binding site [ion binding site]
Evidence:
  • Comment:annotation based on homology to other subfamilies

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               # #                                                        #             
YP_002334069   1 MKIYVSIDFEGLGGVtqwsdv----eygvkfKQNYLMEQLKAFLRATDg-------NYVLLVDSHAMGDNILWEITke-f 68  Thermosipho afr...
YP_001741076   1 MKIYISTDMEGIPGTfnweqektnrpevlknYQTHITDCLNAILYSGFke----fiEEITIADSHAGGDNLSYEITal-d 75  Candidatus Cloa...
Q830Q1         1 MKIYVSCDIEGLAGIatfdme----kedtvlFRELYHQHVAWLIEGIQksakneqiTEITIADSHSRGLNLAYARLaemd 76  Enterococcus fa...
EFD87937       1 MKIYISTDIEGLAGIvdwdme----sgdteiFRNLYNEQLEWVLEGIQkssvnekiTDILLVDSHAKGNNLSYDRLsdfd 76  Oenococcus oeni...
ABV33268       1 MKIYISVDMEGLAGIsmwqev----dpgnkqSIDLLQEHLKAVLDGLFdsg--adiSEVVISDSHSRGDNIPYGITkq-y 73  Thermotoga lett...
EEG55370       1 MKIYISVDMEGMAGItapfqe----keevpsFRRALHNQIRWIIDGIRqsavngsvEEITISDSHGSGTNLSYDELcamd 76  Clostridium asp...
ABX31234       4 IKIYISFDFEGLGGVaqwndvt---kdnkdyKQTYAVRQLKALLEELKe-------HEIILSDSHAEGNNIPWEITee-f 72  Petrotoga mobil...
ACR78990       1 MKIFISTDMEGIAGVvswnem----ksnnkiYTTMQNTELNWVIELIKesklneqvEEIVICDSHSRGENLPFGGIsd-- 74  Thermotogales b...
ABS61623       5 KKIFISFDFEGLAGItnwsdvd---krsadyKREYMLKQLRAFLNGLGn-------SEILLVDSHASGDNIPWEITse-f 73  Fervidobacteriu...
ZP_03488867    2 KKIYISADIEGIWGNsnpantak-ngylyseYCTNMMNEVNLVIDLLFqn----gvEEVVVNDGHGNMDNLLPSKLd--- 73  Eubacterium bif...
Feature 1                                         #                              #               
YP_002334069  69 eNVELISG--GLRKNYMMSGLDEsFDRVVFFGYHAGVGTryAVMDHSYSSsSIYNIWINGqkMNEALINAAYAGLYNVPV 146 Thermosipho afr...
YP_001741076  76 kRISLISG--GPRPQYMMPALDSdYAMVFLLGYHSGTGTwkGNMDHTYSNsKIFRIWINDipMNEAIINSAYAGYKGVPV 153 Candidatus Cloa...
Q830Q1        77 eRISLVSG--FPRMDYMMSGLDSsYDVVFFLGYHAGIGKqkGNMDHGYSAsVAYDLKINDlaMNETTINAAYASELGVPV 154 Enterococcus fa...
EFD87937      77 dRISLLSG--WPREDYMMSCLDNsFDQVVFVGYHAGIGKqgGNMDHGYSArSAYKIWINNkyQNETTINVAYASEVGVPV 154 Oenococcus oeni...
ABV33268      74 dRVKIVHG--SLRKDFMMSGLNEsFDRVFFIGYHAGIGCqnGIMDHTYSSsLVHNIWINGkrMNEAVINAAFAGYHGVPV 151 Thermotoga lett...
EEG55370      77 eRISLVSG--SPRKHFMMSCLDEsYDVVFLAGYHAGPGEplANMDHSFSGrAVGCLKINGhyMNESTTNAALAGDYGVPV 154 Clostridium asp...
ABX31234      73 pNVKLISG--GIRKYYMMTGIDEsFDRMIFFGYHAGVGEkySTMDHTYSSsSIHNIWINGieMNETLINAAYGGSFDVPL 150 Petrotoga mobil...
ACR78990      75 hRVSWIRG--YPRPFYMMQGLDNsFDLVMLLGYHGKVGSfrAGMDHTYAGsCIYNIRLNGkeVGETEINAYYAGVFGVPV 152 Thermotogales b...
ABS61623      74 pNVNLVSG--GIRRYYMMYGIDEsFDYIVFFGYHAGIGTesANMDHTYSSsSIHNLWINGleMNEALINAAFGGLYNVPV 151 Fervidobacteriu...
ZP_03488867   74 pRAAFVAAngAYKEFGMMEGLDDsFDGAMFIGYHSRCNSp-GVMAHTIWGtMVRKVVVDGkeLGESGINRLLADEFGVPV 152 Eubacterium bif...
Feature 1                                                                                        
YP_002334069 147 AMIVGD-----DKLKGQVFd-----DVFFVETKESLGRFSAKHKsmKKVLKEIEETTRRMLQvp--rEKFKVYKFdtPVE 214 Thermosipho afr...
YP_001741076 154 ALISGD-----KALEEQIAvt--mpWVHFVRTKEAVAKFAAKNYssIIVKEDLVKAVQTSLAq----KDIPLYTFssPIR 222 Candidatus Cloa...
Q830Q1       155 GLIIGE-----SGLEEQLFqekmmpEVPFVSTKESLGRYAIKNRpmQQVREAIVATTSQVLTsf-alSELPRYALqtPAT 228 Enterococcus fa...
EFD87937     155 TLVIGDsalkeQLIDEHMFd-----SPKYVTTKKSLARYAALSFprKKVRTATIDAVKEVLQnpapySTLPIPKL--PAR 227 Oenococcus oeni...
ABV33268     152 ALIVGDe----MLKRELKDlf--mgKYEYVVTKEGISRYAAIMKpiTSVMSEIKQAVKKAVEie--rHQLPLINFanPVE 223 Thermotoga lett...
EEG55370     155 ALVAGDsg--lRRQLIDQKqm---pWVEFVTTKESLSRYAAKFPpqKKLREDTVAAVKRVLEsd--lKALPLYRVeaPIR 227 Clostridium asp...
ABX31234     151 AMVVGDd----KLKKQLNPyf---kHLYYVETKRSLGRYSAEFKpmKKLLEEIKSATKEMKDkn--kEYFDVYRFnsPIE 221 Petrotoga mobil...
ACR78990     153 GLITGDd----VLEKQVKEff--gnDFPFVRTKEGIGRFSAKVYhpVKVKKAYEKAFEKLLEq---lDSLEVKKLngEIT 223 Thermotogales b...
ABS61623     152 GCIVGDd----KVVQQTKKyi---pKALYSVTKESIGRHSAVMRpmKDLLTELEENAKALIQre--kSEFDIFGFkkPIE 222 Fervidobacteriu...
ZP_03488867  153 ILASGDs----EYGKQVEEe----lRCVFVETKKTLNNQCALCCsfNELKNRYTKGIQEALK-----VDEKPTLSs-SHA 218 Eubacterium bif...
Feature 1                                                        
YP_002334069 215 LVVEFTDTARADLVEMLPLVERVNGRSVKLVHEDYQVIFDAILSMAFM 262 Thermosipho africanus TCF52B
YP_001741076 223 LKIEFHSTSMTDCAALMPHTKRLDGRTIEYVDDDYGVIFETIMALVTL 270 Candidatus Cloacamonas acidaminovorans
Q830Q1       229 VKLQCVTTAQADRIEMLPMIKRIDGRTVSFVGETMKDVMNGIVAVVGL 276 Enterococcus faecalis
EFD87937     228 LKVQVYNTAQADAISQLQDINRIDGRTIETTANSIHDLMNEILAIVAI 275 Oenococcus oeni AWRIB429
ABV33268     224 LRVEFKDTSYADAVELMPGVERIDGRTVSLSHDQYPVVFNALMAMIYI 271 Thermotoga lettingae TMO
EEG55370     228 LAIDFKTTAMAEMVAQLPMVERVNGTEVDVICQDMTEVECAISAITGL 275 Clostridium asparagiforme DSM 15981
ABX31234     222 MIVEFSDTSKADMVESMPLTERIDGRKVKISSDNYRVIFEALLAITYI 269 Petrotoga mobilis SJ95
ACR78990     224 LEVDLVTTVVADAVAIIPGLTRTSGRTVRYTSTEYLEIFRMILAIAML 271 Thermotogales bacterium TBF 19.5.1
ABS61623     223 MIVEFSDTLRADLVSSMPLVERLDGRKVRIIHEDYKVIFEALLAMTYI 270 Fervidobacterium nodosum Rt17-B1
ZP_03488867  219 MDITFHHSRNADFVSRMDNVEKMDDCTVRINKETYKDLYALMRFVIKV 266 Eubacterium biforme DSM 3989

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap