Conserved Protein Domain Family
Cyt_b561_ACYB-1_like

?
cd08766: Cyt_b561_ACYB-1_like 
Plant cytochrome b(561), including the carbon monoxide oxygenase ACYB-1.
Cytochrome b(561), as found in plants, similar to the Arabidopsis thaliana ACYB-1 gene product, a cytochrome b561 isoform localized to the tonoplast. This protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), and might be capable of trans-membrane electron transport from intracellular ascorbate to extracellular ferric chelates. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
Statistics
?
PSSM-Id: 176496
View PSSM: cd08766
Aligned: 15 rows
Threshold Bit Score: 181.736
Threshold Setting Gi: 75142280
Created: 29-Apr-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative heme
Feature 1:putative heme binding sites [chemical binding site]
Evidence:
  • Comment:four conserved histidines may be involved in heme coordination

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               #                                   #                                 
NP_198679  41 SDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQ---GTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDkgIENFYSL 117 thale cress
ABK22502   47 DQNKTKIFNVHPVFMFVGFIFLSSQAILAYKMIP---AKKEVQKTVHLVLQGSAIVLGAIGIYAVFKFHNEskIKNLYSL 123 Sitka spruce
Q6Z1Y9     47 SHNKQLIFNTHPVLMVLGLVVLAAEAILSYRSLSiivSSRDARKKVHLGLHAVGLALGGVGIYAVFKYHAEadIPNLYSL 126 Oryza sativa Japon...
AAD11424   28 SSNPYQILNVHPFMMFFGFIFFAGEAMMAYKTVR---AVHPMQKTIHMADHIVAITLGIIGIYAAFKYHDRrnLTNMYTL 104 common iceplant
ABF98559   51 SDDPEQIFNVHPFVMCWGFILLIGEAILAYTTIP---MDHRTQKMVHMLVHLVALILAIFGVYAAFKFHDAavAPDLVSL 127 Japanese rice
ABK25854   43 ATNKSHIFNLHPVLMLIGFIFIASEAILAYKVLP---GDRAYKKSVHLSLQLVALVLGIIGIYTAFKYHNEsgIVNLYSW 119 Sitka spruce
NP_172926  47 SDNPLKVLNVHPFLMYCGFLFLVGQAMMTYKTAY---ASHQVQKMVHGGLHLIGLVLGIVGICAAFRFHDKvnLKDMVSL 123 thale cress
ACJ84591   36 SGNPLRVFNTHPFLMYFGFIFLVGQAIMSYHTVP---GTHETQKIVHMTLHFIAIVLGIVGICAVFKFHDMvnLVDVYSL 112 barrel medic
Q7XH60     49 SSTPQLVYTAHPLFMVIGLVICTGEAIMAYRIML---GSREVKKAVHLLLHLVALAFAAVGLYAAFKFHHDlrAPDIRSL 125 Oryza sativa Japon...
EEE61401  138 YCNKLDEYMVHPVLMLIGYIILGSEAIMIYKIFPk--LNHDTTKLIHLILHAIAIVLGAVGIYCAFKFHNEsgIANLYSL 215 Japanese rice
Feature 1     #                                      #                           
NP_198679 118 HSWLGLACLFLFAFQWAAGFVTYWYPGGSrnSRASLMPWHVFLGISIYALALVTATTGILEKVTFLQ 184 thale cress
ABK22502  124 HSWLGIATISLFGLQWIAALLAFAFPGASkqRREAIYPWHVFLGVFLYAMAIGTAELGILERLTFQQ 190 Sitka spruce
Q6Z1Y9    127 HSWIGIATISLYALHWLLAFLTFFFPGAShdTRRSAVPWHALLGLLVFALAVGNAQLGFLEKLTFLQ 193 Oryza sativa Japonica Group
AAD11424  105 HSWIGLGTFILYGIQWLFGFATFWLPRPLe-TRERTMPWHVCFGRALLYMAICAAETGLMQIFTILN 170 common iceplant
ABF98559  128 HSWLGILAVALFGLQWLFGFFAFWLPGTHerTRAAAAPAHVAAGLAIFMLAVCAAETGLVQKSAAAA 194 Japanese rice
ABK25854  120 HSWLGLGTICLFAIQWLVGFFVFFYPGAAdpIRAAIHPWHVFFGVLIYLFAIATAELGFLEKLTFLE 186 Sitka spruce
NP_172926 124 HSWIGLTTFILLGVQWLFGAFTFLAPQSSsgTRTRMMPWHVLGGRALLYMGIVAALTGLMQRATMLG 190 thale cress
ACJ84591  113 HSWIGIGTFCLFGLQWLFGLTFMFQGTRQ--SRAAMAPWHIAGGRALFYMAICAALTGLMERSAMLK 177 barrel medic
Q7XH60    126 HAWLGITTAALYAFQWLVGFVYFVFPGAVmtMRADYAPWHILLGIVIFLMAICTAETGLARFIFPFH 192 Oryza sativa Japonica Group
EEE61401  216 HSWLGIGTISLYGIQWIFGFVAFFYPGAAphVRRGALPWHVLFGLFVYVLTLATAELGLLEKLTFLQ 282 Japanese rice

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap