Conserved Protein Domain Family
Cyt_b561_CG1275_like

?
cd08764: Cyt_b561_CG1275_like 
Non-vertebrate eumetazoan cytochrome b(561)
Cytochrome b(561), as found in non-vertebrate eumetazoans, similar to the Drosophila melanogaster CG1275 gene product. This protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
Statistics
?
PSSM-Id: 176494
View PSSM: cd08764
Aligned: 10 rows
Threshold Bit Score: 304.639
Threshold Setting Gi: 156222746
Created: 3-May-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative heme
Feature 1:putative heme binding sites [chemical binding site]
Evidence:
  • Comment:four conserved histidines may be involved in heme coordination

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                      #                                 #               
Q9I7U1       121 VLVATWIGQHFGGLAGTSN----PGVEFNWHPLFMTIGFIYLYGNSILIYRGFRTTRKKTLKLTHAGIHMGAFILTVIAL 196 fruit fly
Q5D8X4        32 VVLTAVWLGKFWGGFSWTN----ANTVFNYHPLFSVLGLVFLYGDSILVFRVFRSYRKLPVKILHAVLHILAFLFGVLGI 107 Schistosoma jap...
EFA05356      28 LVMVLSWLVKYRDGFSWSD----PQLQFNWHPLLMVTGLVFLYGQSILIYRTGRNATKKRLKVTHALLHLSAFILAVIGL 103 red flour beetle
ACO15392      26 VVLVGVWMGHFRGGFAWTEt---PGLMFNWHPLLMTLGLIYFYGNGMLVYRNFRGEAKKRLKLLHAGLLIGCLVLASVGL 102 Caligus clemensi
Q9BPQ6        33 GLAIVIMTAVWMGVLQDGGfgwtKELVFRYHPMFMILGMIFIYGNAIMVYRVFRNTKKIRAKWLHAVLNLLALILGSVGL 112 Dugesia japonica
XP_002732687  22 ITLIGVWMGKYLGGFAWDG----SDQQFNLHPLLMTVGLIFLYAEAMLVYRVFRNTTKIYIKCLHGMIHLLALICAVIGL 97  Saccoglossus ko...
EDS29553      29 VVLVSSWIGVHLGGLGWTK----PSIQFNWHPLLMSLGMIFLYGNSILVYRGFRYARKKPLKITHATIHGLAFLFTVVAL 104 southern house ...
EDO43587      30 IVLTGIWMGKYRGGFAWDG----SGQQFNYHPVCMVIGLVYLYSEAMIVYRVFRNETKYTVKLVHFALQLVAFFVAVFGL 105 starlet sea ane...
EEC07620      32 VLLVTIWASNFMGGFSGPSn---PKLEFNYHPVFMVLGMVFLYGNGILVYRALRTERKSRLKLVHGALMALAFLCAVAAL 108 black-legged tick
EEB13963      24 LILTAIWLGSYRGGFTWTSn---PKLEFNWHPLLMMMGMIFLYANGILVYRSFRNSRKRKLKIAHAFINAMAFIFTIIGL 100 human body louse
Feature 1                             #                                      #                   
Q9I7U1       197 KTVFDSHNLAn-pPIPNMYSLHSWLGLSAVIVFSLQYVAGFVAFLAPGLREnYRIAMMPLHIYFGLFGFVLAIASALMGI 275 fruit fly
Q5D8X4       108 KAAFDMHNAL---SIPNLYSLHSWLGITAIVVFGLQWVGGLIGFLVPQTPQiARSKLLPIHVTFGSFLYLLMIGVCISGI 184 Schistosoma jap...
EFA05356     104 KAAFDSHNYAk-pPKPNLYTLHSWFGLVAVIIFTGQFVFGFVSFLFPGLSRtLRAAFLPVHVATGIATFTLCVVTALVGI 182 red flour beetle
ACO15392     103 KAVFDSHNLAi-pPVPNLYSLHSWIGITVVVLFACQWISGLVIYLYPGLAShLKVSFLPTHTFLGTMIFVLSIVTALLGI 181 Caligus clemensi
Q9BPQ6       113 KAVFDSHNMK---GTANMYSLHSWVGLGCVILFGCQWVLGFISFLFPKLPEtLRSAIMPLHRSLGMIILGLAVAAAVMGI 189 Dugesia japonica
XP_002732687  98 KAVFDNHNFN---GITNMYSLHSWIGITTVVLFSLQLLCGFVSFLVPGVSRtLRASYLPTHVFFGVFIFGMAVASALMGI 174 Saccoglossus ko...
EDS29553     105 IAVFDSHNLAk-pPIPNMYSLHSWVGMAAVVLFSLQYVLGFVSYLFPGVREtLRATYMPVHVFYGLLGFVLAIAASLLGL 183 southern house ...
EDO43587     106 KAAFDFHNKQ---GFPNMYSLHSWLGLCTVLLFTFQLVGGFVSFLYPKLPDaPRASYLKVHVFFGVFVFVLAVTTCLTGM 182 starlet sea ane...
EEC07620     109 KTVFDSHNLNqpaAIPNLYSLHSWLGLTAVLLFCMQLLTGFVSFLFPGVRQwLRAQYLPLHVFFGLAIFGLAVATALLGI 188 black-legged tick
EEB13963     101 QAVFDSHNLAspsPIPNMYSLHSWLGLASVILFALQWVFGLLSFLYPTLSApLRATYYPIHVFFGINAFVCASASALLGL 180 human body louse
Feature 1                                                                      
Q9I7U1       276 TEKAIFAIktp-aysTLPPAGVLANVIGVMYVVFGALVVYLATEPSYKRKPIPEDTALLNSS 336 fruit fly
Q5D8X4       185 TEKNFFSKny----sVLNARELIGNLIGVVLVIFGGLIFYLTHHPNYRRIEPVPPECRALQK 242 Schistosoma japonicum
EFA05356     183 TEKTIWTLgsk--yqDLPSEGVMVNFIGLFIAFWGILVLYLVNDVDFKRANLPEDEVALSNS 242 red flour beetle
ACO15392     182 SEKIFFALnktkkyqNRDAEGVIANWLGLALVGFGLIVVYLVRNPRYERLTRPEEELILYEN 243 Caligus clemensi
Q9BPQ6       190 TEYNNNDK-------SKSPSTMLGNFIGIISLIFVSIVLFLVIWSEYRRIEPGTEEERIILN 244 Dugesia japonica
XP_002732687 175 TEKLLFTLdn---ysDLPAEARIANTAGICFLVFAGIIGYLVTRHDFKREEVDYEHEPLAMD 233 Saccoglossus kowalevskii
EDS29553     184 SEKAFFSIpn---lsNLPAPAVLVNMIGMLLLVYGGLVVFLVTEVGYKRKPLPEDVMLLTHS 242 southern house mosquito
EDO43587     183 TEKALFSIpkt--ysKFVPEGVLINTLGIVLILLAAITVFVVTNKDFQREEPTAEQVALIQN 242 starlet sea anemone
EEC07620     189 SEKLFFRLasn--ysNLPGEAALGNLLGLCLLSFAVLVVFLATRTSYRRTPLPEEASLPLQP 248 black-legged tick
EEB13963     181 TEKAIFNVsd---ysQFSSEGLLVNCIGVTIVIFTSLVVHLVTEVKFKRHPLPEDEMLLTSN 239 human body louse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap